Protein or Target Summary
Gamma-aminobutyric acid receptor subunit theta
| Gene ID | 55879 |
|---|---|
| uniprot | Q9UN88 |
| Gene Name | GABRQ |
| Ensernbl ID | ENSP00000469332 |
| Family | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRQ sub-subfamily. |
| Sequence | MGIRGMLRAAVILLLIRTWLAEGNYPSPIPKFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGGAPVPVRISIYVTSIEQISEMNMDYTITMFFHQTWKDSRLAYYETTLNLTLDYRMHEKLWVPDCYFLNSKDAFVHDVTVENRVFQLHPDGTVRYGIRLTTTAACSLDLHKFPMDKQACNLVVESYGYTVEDIILFWDDNGNAIHMTEELHIPQFTFLGRTITSKEVYFYTGSYIRLILKFQVQREVNSYLVQVYWPTVLTTITSWISFWMNYDSSAARVTIGLTSMLILTTIDSHLRDKLPNISCIKAIDIYILVCLFFVFLSLLEYVYINYLFYSRGPRRQPRRHRRPRRVIARYRYQQVVVGNVQDGLINVEDGVSSLPITPAQAPLASPESLGSLTSTSEQAQLATSESLSPLTSLSGQAPLATGESLSDLPSTSEQARHSYGVRFNGFQADDSIFPTEIRNRVEAHGHGVTHDHEDSNESLSSDERHGHGPSGKPMLHHGEKGVQEAGWDLDDNNDKSDCLAIKEQFKCDTNSTWGLNDDELMAHGQEKDSSSESEDSCPPSPGCSFTEGFSFDLFNPDYVPKVDKWSRFLFPLAFGLFNIVYWVYHMY Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 55879 | GABRQ | Gamma-aminobutyric acid receptor subunit theta | Q9UN88 |
| MOUSE | 57249 | Gabrq | Gamma-aminobutyric acid receptor subunit theta | Q9JLF1 |
| MOUSE | 57249 | Gabrq | Uncharacterized protein | Q3TP00 |
| MOUSE | 57249 | Gabrq | Gamma-aminobutyric acid receptor subunit theta | B1AUQ5 |
| MOUSE | 57249 | Gabrq | Gamma-aminobutyric acid (GABA-A) receptor, subunit theta | Q0VEX8 |
| RAT | 65187 | Gabrq | GABA theta subunit | Q91ZM7 |
| RAT | Gabrq | Gamma-aminobutyric acid type A receptor theta subunit | G3V875 |
Protein Classes
PANTHER Classes
protein / transporter / ligand-gated ion channel / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / ion channel / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / acetylcholine receptor / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / GABA receptor / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / receptor / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / ligand-gated ion channel / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / ion channel / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / acetylcholine receptor / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / GABA receptor / Gamma-aminobutyric acid receptor subunit theta
protein / transporter / receptor / Gamma-aminobutyric acid receptor subunit theta
DTO Classes
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / Gamma-aminobutyric acid receptor subfamily / GABRQ sub-subfamily / Gamma-aminobutyric acid receptor subunit theta
protein / Ion channel / Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family / Gamma-aminobutyric acid receptor subfamily / GABRQ sub-subfamily / Gamma-aminobutyric acid receptor subunit theta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx