JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Alpha-crystallin A chain

Gene ID	1404
uniprot	P02489
Gene Name	CRYAA
Ensernbl ID	ENSP00000482816
Family	Belongs to the small heat shock protein (HSP20) family.
Sequence	MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1404	CRYAA	Alpha-crystallin A chain	P02489
MOUSE	12954	Cryaa	Alpha-crystallin A chain	P24622
MOUSE	12954	Cryaa	Cryaa protein	Q569M7
MOUSE	12954	Cryaa	Alpha-A-crystallin	Q546L9
RAT	24273	Cryaa	Alpha-crystallin A chain	P24623
RAT	24273	Cryaa	Crystallin, alpha A	A0JN13

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx