Protein or Target Summary
Gamma-butyrobetaine dioxygenase
| Gene ID | 8424 |
|---|---|
| uniprot | O75936 |
| Gene Name | BBOX1 |
| Ensernbl ID | ENSP00000263182 |
| Family | Belongs to the gamma-BBH/TMLD family. |
| Sequence | MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 8424 | BBOX1 | Gamma-butyrobetaine dioxygenase | O75936 |
| MOUSE | Bbox1 | Gamma-butyrobetaine dioxygenase | A2AGK3 | |
| MOUSE | 170442 | Bbox1 | Gamma-butyrobetaine dioxygenase | Q924Y0 |
| RAT | Bbox1 | Gamma butyrobetaine hydroxylase | A6YRI8 | |
| RAT | Bbox1 | Gamma-butyrobetaine dioxygenase | A0A0G2K461 | |
| RAT | Bbox1 | Gamma-butyrobetaine dioxygenase | A0A0G2K5N7 | |
| RAT | 64564 | Bbox1 | Gamma-butyrobetaine dioxygenase | Q9QZU7 |
Protein Classes
PANTHER Classes
protein / oxidoreductase / oxygenase / Gamma-butyrobetaine dioxygenase
protein / oxidoreductase / hydroxylase / Gamma-butyrobetaine dioxygenase
protein / oxidoreductase / oxygenase / Gamma-butyrobetaine dioxygenase
protein / oxidoreductase / hydroxylase / Gamma-butyrobetaine dioxygenase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx