The store will not work correctly when cookies are disabled.
DAZ2
Description | Deleted in azoospermia protein 2 |
---|
Gene and Protein Information
Gene ID | 57055 |
Uniprot Accession IDs | Q2KHN6 Q96P41 Q9NR91 |
Symbol | pDP1678 |
Family | Belongs to the RRM DAZ family. |
Sequence | MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 744621 | LOC744621 | deleted in azoospermia protein 4 | 9598 | | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|