The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
BIRC8
Description | Baculoviral IAP repeat-containing protein 8 |
---|
Gene and Protein Information
Gene ID | 112401 |
Uniprot Accession IDs | Q6IPY1 Q96RW5 |
Ensembl ID | ENSP00000412957 |
Symbol | ILP2 ILP2 ILP-2 hILP2 RNF136 |
Family | Belongs to the IAP family. |
Sequence | MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS |
---|
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|