My Cart
You have no items in your shopping cart.
Description | Baculoviral IAP repeat-containing protein 8 |
---|
Gene ID | 112401 |
---|---|
Uniprot Accession IDs | Q6IPY1 Q96RW5 |
Ensembl ID | ENSP00000412957 |
Symbol | ILP2 ILP2 ILP-2 hILP2 RNF136 |
Family | Belongs to the IAP family. |
Sequence | MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS |
1.Richter, B W BW and 13 more authors. 2001-07 Molecular cloning of ILP-2, a novel member of the inhibitor of apoptosis protein family. [PMID:11390657] |
2.Lagacé, M M and 6 more authors. 2001-10 Genomic organization of the X-linked inhibitor of apoptosis and identification of a novel testis-specific transcript. [PMID:11597143] |
3.Jin, Xin X, Mitsumata, Masako M, Yamane, Tetsu T and Yoshida, Yoji Y. 2002-10-09 Induction of human inhibitor of apoptosis protein-2 by shear stress in endothelial cells. [PMID:12372615] |
4.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932] |
5.Shin, Hwain H and 5 more authors. 2005-01-01 The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition. [PMID:15485395] |
6.Kimura, Kouichi K and 31 more authors. 2006-01 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. [PMID:16344560] |
7.Flachsbart, Friederike F and 6 more authors. 2010-12-10 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study. [PMID:20800603] |
8.Gaudet, Pascale P, Livstone, Michael S MS, Lewis, Suzanna E SE and Thomas, Paul D PD. 2011-09 Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium. [PMID:21873635] |
9.Xiang, Mingjun M, Zhou, Wei W, Gao, Dandan D, Fang, Xiansong X and Liu, Qian Q. 2012-12-07 Inhibitor of apoptosis protein-like protein-2 as a novel serological biomarker for breast cancer. [PMID:23222679] |
10.Glodkowska-Mrowka, Eliza E and 7 more authors. 2014-03 Differential expression of BIRC family genes in chronic myeloid leukaemia--BIRC3 and BIRC8 as potential new candidates to identify disease progression. [PMID:24266799] |