The store will not work correctly when cookies are disabled.
BIRC8
| Description | Baculoviral IAP repeat-containing protein 8 |
|---|
Gene and Protein Information
| Gene ID | 112401 |
|---|
| Uniprot Accession IDs | Q6IPY1 Q96RW5 |
|---|
| Ensembl ID | ENSP00000412957 |
|---|
| Symbol | ILP2 ILP2 ILP-2 hILP2 RNF136 |
|---|
| Family | Belongs to the IAP family. |
|---|
| Sequence | MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
