Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

BIRC8

DescriptionBaculoviral IAP repeat-containing protein 8

Gene and Protein Information

Gene ID112401
Uniprot Accession IDs Q6IPY1 Q96RW5
Ensembl ID ENSP00000412957
Symbol ILP2 ILP2 ILP-2 hILP2 RNF136
FamilyBelongs to the IAP family.
Sequence
MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    protease inhibitor    /    Baculoviral IAP repeat-containing protein 8
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Baculoviral IAP repeat-containing protein 8

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Richter, B W BW and 13 more authors. 2001-07 Molecular cloning of ILP-2, a novel member of the inhibitor of apoptosis protein family. [PMID:11390657]
      2.Lagacé, M M and 6 more authors. 2001-10 Genomic organization of the X-linked inhibitor of apoptosis and identification of a novel testis-specific transcript. [PMID:11597143]
      3.Jin, Xin X, Mitsumata, Masako M, Yamane, Tetsu T and Yoshida, Yoji Y. 2002-10-09 Induction of human inhibitor of apoptosis protein-2 by shear stress in endothelial cells. [PMID:12372615]
      4.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      5.Shin, Hwain H and 5 more authors. 2005-01-01 The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition. [PMID:15485395]
      6.Kimura, Kouichi K and 31 more authors. 2006-01 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. [PMID:16344560]
      7.Flachsbart, Friederike F and 6 more authors. 2010-12-10 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study. [PMID:20800603]
      8.Gaudet, Pascale P, Livstone, Michael S MS, Lewis, Suzanna E SE and Thomas, Paul D PD. 2011-09 Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium. [PMID:21873635]
      9.Xiang, Mingjun M, Zhou, Wei W, Gao, Dandan D, Fang, Xiansong X and Liu, Qian Q. 2012-12-07 Inhibitor of apoptosis protein-like protein-2 as a novel serological biomarker for breast cancer. [PMID:23222679]
      10.Glodkowska-Mrowka, Eliza E and 7 more authors. 2014-03 Differential expression of BIRC family genes in chronic myeloid leukaemia--BIRC3 and BIRC8 as potential new candidates to identify disease progression. [PMID:24266799]