The store will not work correctly when cookies are disabled.
BRS3
| Description | Bombesin receptor subtype-3 |
|---|
Gene and Protein Information
| Gene ID | 680 |
|---|
| Uniprot Accession IDs | BRS-3 |
|---|
| Ensembl ID | ENSP00000359682 |
|---|
| Symbol | BB3 BB3R |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737980 | BRS3 | bombesin receptor subtype 3 | 9598 | VGNC:1410 | OMA, EggNOG |
| Mouse | 12209 | Brs3 | bombesin-like receptor 3 | 10090 | MGI:1100501 | Inparanoid, OMA, EggNOG |
| Rat | 260319 | Brs3 | bombesin receptor subtype 3 | 10116 | RGD:628645 | Inparanoid, OMA, EggNOG |
| Dog | 613002 | BRS3 | bombesin receptor subtype 3 | 9615 | VGNC:38535 | Inparanoid, OMA, EggNOG |
| Horse | 100054718 | BRS3 | bombesin receptor subtype 3 | 9796 | VGNC:15898 | Inparanoid, OMA, EggNOG |
| Cow | 539011 | BRS3 | bombesin receptor subtype 3 | 9913 | VGNC:26574 | Inparanoid, OMA, EggNOG |
| Opossum | 100009904 | BRS3 | bombesin receptor subtype 3 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100083667 | BRS3 | bombesin receptor subtype 3 | 9258 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100488712 | brs3 | bombesin like receptor 3 | 8364 | XB-GENE-960289 | Inparanoid, OMA |
| Fruitfly | 35535 | CCHa2-R | CCHamide-2 receptor | 7227 | FBgn0033058 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
