BRS3

DescriptionBombesin receptor subtype-3

Gene and Protein Information

Gene ID680
Uniprot Accession IDs BRS-3
Ensembl ID ENSP00000359682
Symbol BB3 BB3R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737980BRS3bombesin receptor subtype 39598VGNC:1410OMA, EggNOG
Mouse12209Brs3bombesin-like receptor 310090MGI:1100501Inparanoid, OMA, EggNOG
Rat260319Brs3bombesin receptor subtype 310116RGD:628645Inparanoid, OMA, EggNOG
Dog613002BRS3bombesin receptor subtype 39615VGNC:38535Inparanoid, OMA, EggNOG
Horse100054718BRS3bombesin receptor subtype 39796VGNC:15898Inparanoid, OMA, EggNOG
Cow539011BRS3bombesin receptor subtype 39913VGNC:26574Inparanoid, OMA, EggNOG
Opossum100009904BRS3bombesin receptor subtype 313616Inparanoid, OMA, EggNOG
Platypus100083667BRS3bombesin receptor subtype 39258Inparanoid, OMA, EggNOG
Xenopus100488712brs3bombesin like receptor 38364XB-GENE-960289Inparanoid, OMA
Fruitfly35535CCHa2-RCCHamide-2 receptor7227FBgn0033058Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Bombesin receptor    /    Bombesin receptor subtype-3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source