The store will not work correctly when cookies are disabled.
C3AR1
Description | C3a anaphylatoxin chemotactic receptor |
---|
Gene and Protein Information
Gene ID | 719 |
Uniprot Accession IDs | O43771 Q92868 C3AR |
Ensembl ID | ENSP00000302079 |
Symbol | AZ3B C3R1 HNFAG09 AZ3B C3AR HNFAG09 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 466942 | C3AR1 | complement C3a receptor 1 | 9598 | VGNC:5313 | OMA, EggNOG |
Macaque | 716086 | C3AR1 | complement C3a receptor 1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 12267 | C3ar1 | complement component 3a receptor 1 | 10090 | MGI:1097680 | Inparanoid, OMA, EggNOG |
Rat | 84007 | C3ar1 | complement C3a receptor 1 | 10116 | RGD:620537 | Inparanoid, OMA, EggNOG |
Dog | 486704 | C3AR1 | complement C3a receptor 1 | 9615 | VGNC:38592 | Inparanoid, OMA, EggNOG |
Horse | 100053275 | C3AR1 | complement C3a receptor 1 | 9796 | VGNC:15952 | Inparanoid, OMA, EggNOG |
Cow | 540702 | C3AR1 | complement C3a receptor 1 | 9913 | VGNC:26639 | Inparanoid, OMA, EggNOG |
Chicken | 418198 | C3AR1 | complement C3a receptor 1 | 9031 | CGNC:9977 | Inparanoid, OMA, EggNOG |
Anole lizard | 100559802 | c3ar1 | complement C3a receptor 1 | 28377 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|