The store will not work correctly when cookies are disabled.
Protein or Target Summary
CDC42 small effector protein 1
| Gene ID | 56882 |
|---|
| uniprot | Q9NRR8 |
|---|
| Gene Name | CDC42SE1 |
|---|
| Ensernbl ID | ENSP00000475845 |
|---|
| Family | Belongs to the CDC42SE/SPEC family. |
|---|
| Sequence | MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 56882 | CDC42SE1 | CDC42 small effector protein 1 | Q9NRR8 |
| MOUSE | | Cdc42se1 | CDC42 small effector protein 1 | D3YUZ5 |
| MOUSE | 57912 | Cdc42se1 | CDC42 small effector protein 1 | Q8BHL7 |
| RAT | 499672 | Cdc42se1 | CDC42 small effector protein 1 | Q5BJM7 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
