Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CA14

DescriptionCarbonic anhydrase 14

Gene and Protein Information

Gene ID23632
Uniprot Accession IDs Q5TB24 Q8NCF4
Ensembl ID ENSP00000358107
Symbol CAXiV
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469479CA14carbonic anhydrase 149598VGNC:9849OMA, EggNOG
Macaque706360CA14carbonic anhydrase 149544Inparanoid, OMA, EggNOG
Mouse23831Car14carbonic anhydrase 1410090MGI:1344341Inparanoid, OMA, EggNOG
Rat791259Car14carbonic anhydrase 1410116RGD:1599277Inparanoid, OMA, EggNOG
Dog100855809CA14carbonic anhydrase 149615VGNC:38609Inparanoid, OMA, EggNOG
Horse100054535CA14carbonic anhydrase 149796VGNC:15962Inparanoid, OMA, EggNOG
Cow509027CA14carbonic anhydrase 149913VGNC:26652Inparanoid, OMA, EggNOG
Pig100153371CA14carbonic anhydrase 149823OMA, EggNOG
Opossum100016752CA14carbonic anhydrase 1413616Inparanoid, OMA, EggNOG
Xenopus100126213ca14carbonic anhydrase 148364XB-GENE-855636Inparanoid, OMA, EggNOG
Zebrafish567897ca14carbonic anhydrase XIV7955ZDB-GENE-051030-57Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      acute quadriplegic myopathy1255Expression AtlasMONDO:0005336
      atypical teratoid / rhabdoid tumor5491Expression AtlasMONDO:0020560
      glioblastoma5998Expression AtlasMONDO:0018177
      group 3 medulloblastoma7142Expression AtlasMONDO:0007959
      medulloblastoma, large-cell6269Expression AtlasMONDO:0002791
      ovarian cancer8576Expression AtlasMONDO:0008170
      primitive neuroectodermal tumor3050Expression AtlasMONDO:0005462
      psoriasis6696Expression AtlasMONDO:0005083
      Atopic dermatitis0JensenLab Experiment TIGA
      Bipolar disorder0JensenLab Experiment TIGA

      Bibliography

      1.Fujikawa-Adachi, K K, Nishimori, I I, Taguchi, T T and Onishi, S S. 1999-10-01 Human carbonic anhydrase XIV (CA14): cDNA cloning, mRNA expression, and mapping to chromosome 1. [PMID:10512682]
      2.Parkkila, S S and 6 more authors. 2001-02-13 Expression of membrane-associated carbonic anhydrase XIV on neurons and axons in mouse and human brain. [PMID:11172051]
      3.Kaunisto, Kari K and 5 more authors. 2002-06 Carbonic anhydrase XIV: luminal expression suggests key role in renal acidification. [PMID:12028451]
      4.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      5.Juel, C C, Lundby, C C, Sander, M M, Calbet, J A L JA and Hall, G van Gv. 2003-04-15 Human skeletal muscle and erythrocyte proteins involved in acid-base homeostasis: adaptations to chronic hypoxia. [PMID:12611920]
      6.Clark, Hilary F HF and 51 more authors. 2003-10 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [PMID:12975309]
      7.Tarun, Alice S AS, Bryant, Bruce B, Zhai, Wenwu W, Solomon, Colin C and Shusterman, Dennis D. 2003-09 Gene expression for carbonic anhydrase isoenzymes in human nasal mucosa. [PMID:14578124]
      8.Ota, Toshio T and 156 more authors. 2004-01 Complete sequencing and characterization of 21,243 full-length human cDNAs. [PMID:14702039]
      9.Suzuki, Yutaka Y and 7 more authors. 2004-09 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. [PMID:15342556]
      10.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]