Protein or Target Summary

Basal cell adhesion molecule

Gene ID	4059
uniprot	P50895
Gene Name	BCAM
Ensernbl ID	ENSP00000270233
Sequence	MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4059	BCAM	Basal cell adhesion molecule	P50895
MOUSE		Bcam	Bcam protein	Q99K86
MOUSE		Bcam	Basal cell adhesion molecule	D3YTK7
MOUSE		Bcam	Basal cell adhesion molecule	D6RE44
MOUSE		Bcam	Uncharacterized protein	Q8BGB4
MOUSE	57278	Bcam	Basal cell adhesion molecule	Q9R069
RAT	78958	Bcam	Basal cell adhesion molecule	Q9ESS6

Protein Classes

PANTHER Classes
protein / cell adhesion molecule / immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule
protein / cell adhesion molecule / receptor / Basal cell adhesion molecule

DTO Classes
protein / Cell adhesion / Immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx