BCAM
| Description | Basal cell adhesion molecule |
|---|
Gene and Protein Information
| Gene ID | 4059 |
|---|---|
| Uniprot Accession IDs | A8MYF9 A9YWT5 A9YWT6 Q86VC7 |
| Ensembl ID | ENSP00000270233 |
| Symbol | LU MSK19 AU LU CD239 MSK19 |
| Sequence | MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744276 | BCAM | basal cell adhesion molecule | 9598 | VGNC:2582 | OMA, EggNOG |
| Macaque | 714568 | BCAM | basal cell adhesion molecule (Lutheran blood group) | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 57278 | Bcam | basal cell adhesion molecule | 10090 | MGI:1929940 | Inparanoid, OMA, EggNOG |
| Rat | 78958 | Bcam | basal cell adhesion molecule (Lutheran blood group) | 10116 | RGD:68378 | Inparanoid, OMA, EggNOG |
| Dog | 484456 | BCAM | basal cell adhesion molecule | 9615 | VGNC:49023 | Inparanoid, OMA, EggNOG |
| Horse | 100070622 | BCAM | basal cell adhesion molecule | 9796 | VGNC:51000 | Inparanoid, OMA, EggNOG |
| Cow | 282862 | BCAM | basal cell adhesion molecule | 9913 | VGNC:49138 | Inparanoid, OMA, EggNOG |
| Pig | 100738241 | BCAM | basal cell adhesion molecule (Lutheran blood group) | 9823 | OMA, EggNOG | |
| Anole lizard | 103281770 | bcam | basal cell adhesion molecule (Lutheran blood group) | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100036718 | bcam | basal cell adhesion molecule (Lutheran blood group) | 8364 | XB-GENE-921467 | Inparanoid, OMA, EggNOG |
| Zebrafish | 767689 | bcam | basal cell adhesion molecule (Lutheran blood group) | 7955 | ZDB-GENE-060929-620 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / cell adhesion molecule / immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule
protein / cell adhesion molecule / receptor / Basal cell adhesion molecule
protein / cell adhesion molecule / immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule
protein / cell adhesion molecule / receptor / Basal cell adhesion molecule
DTO Classes
protein / Cell adhesion / Immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule
protein / Cell adhesion / Immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|