JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Bone morphogenetic protein 4

Gene ID	652
uniprot	P12644
Gene Name	BMP4
Ensernbl ID	ENSP00000245451
Family	Belongs to the TGF-beta family.
Sequence	MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	652	BMP4	Bone morphogenetic protein 4	P12644
MOUSE	12159	Bmp4	Bone morphogenetic protein 4, isoform CRA_a	Q3ULR1
MOUSE	12159	Bmp4	Bone morphogenetic protein 4	P21275
RAT		Bmp4	Bone morphogenetic protein 4	Q811S3
RAT	25296	Bmp4	Bmp4 protein	Q6AYU9
RAT		Bmp4	Bone morphogenetic protein 4	Q06826

Protein Classes

PANTHER Classes
protein / signaling molecule / growth factor / Bone morphogenetic protein 4

DTO Classes
protein / Signaling / Growth factor / Bone morphogenetic protein 4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx