The store will not work correctly when cookies are disabled.
BID
| Description | BH3-interacting domain death agonist |
|---|
Gene and Protein Information
| Gene ID | 637 |
|---|
| Uniprot Accession IDs | Q549M7 Q71T04 Q7Z4M9 Q8IY86 |
|---|
| Ensembl ID | ENSP00000318822 |
|---|
| Symbol | FP497 |
|---|
| Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 458635 | BID | BH3 interacting domain death agonist | 9598 | VGNC:5229 | OMA, EggNOG |
| Macaque | 100426724 | BID | BH3 interacting domain death agonist | 9544 | | OMA, EggNOG |
| Mouse | 12122 | Bid | BH3 interacting domain death agonist | 10090 | MGI:108093 | Inparanoid, OMA, EggNOG |
| Rat | 64625 | Bid | BH3 interacting domain death agonist | 10116 | RGD:620160 | Inparanoid, OMA, EggNOG |
| Dog | 100683675 | BID | BH3 interacting domain death agonist | 9615 | VGNC:38456 | Inparanoid, OMA, EggNOG |
| Horse | 100054988 | BID | BH3 interacting domain death agonist | 9796 | VGNC:15829 | Inparanoid, OMA, EggNOG |
| Cow | 510373 | BID | BH3 interacting domain death agonist | 9913 | VGNC:26496 | Inparanoid, OMA, EggNOG |
| Pig | 594852 | BID | BH3 interacting domain death agonist | 9823 | | Inparanoid, OMA, EggNOG |
| Chicken | 395236 | BID | BH3 interacting domain death agonist | 9031 | CGNC:9863 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563997 | bid | BH3 interacting domain death agonist | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100036674 | bid | BH3 interacting domain death agonist | 8364 | XB-GENE-956016 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
