JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
BID

BID

Description	BH3-interacting domain death agonist

Gene and Protein Information

Gene ID	637
Uniprot Accession IDs	Q549M7 Q71T04 Q7Z4M9 Q8IY86
Ensembl ID	ENSP00000318822
Symbol	FP497
Sequence	MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458635	BID	BH3 interacting domain death agonist	9598	VGNC:5229	OMA, EggNOG
Macaque	100426724	BID	BH3 interacting domain death agonist	9544		OMA, EggNOG
Mouse	12122	Bid	BH3 interacting domain death agonist	10090	MGI:108093	Inparanoid, OMA, EggNOG
Rat	64625	Bid	BH3 interacting domain death agonist	10116	RGD:620160	Inparanoid, OMA, EggNOG
Dog	100683675	BID	BH3 interacting domain death agonist	9615	VGNC:38456	Inparanoid, OMA, EggNOG
Horse	100054988	BID	BH3 interacting domain death agonist	9796	VGNC:15829	Inparanoid, OMA, EggNOG
Cow	510373	BID	BH3 interacting domain death agonist	9913	VGNC:26496	Inparanoid, OMA, EggNOG
Pig	594852	BID	BH3 interacting domain death agonist	9823		Inparanoid, OMA, EggNOG
Chicken	395236	BID	BH3 interacting domain death agonist	9031	CGNC:9863	Inparanoid, OMA, EggNOG
Anole lizard	100563997	bid	BH3 interacting domain death agonist	28377		Inparanoid, OMA, EggNOG
Xenopus	100036674	bid	BH3 interacting domain death agonist	8364	XB-GENE-956016	Inparanoid, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source