The store will not work correctly when cookies are disabled.
Protein or Target Summary
BH3-interacting domain death agonist
| Gene ID | 637 |
|---|
| uniprot | P55957 |
|---|
| Gene Name | BID |
|---|
| Ensernbl ID | ENSP00000318822 |
|---|
| Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 637 | BID | BH3-interacting domain death agonist | P55957 |
| MOUSE | | Bid | BH3-interacting domain death agonist | D3Z463 |
| MOUSE | 12122 | Bid | BH3-interacting domain death agonist | P70444 |
| RAT | 64625 | Bid | BH3 interacting domain death agonist | A8ASI9 |
| RAT | 64625 | Bid | BH3-interacting domain death agonist | Q9JLT6 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
