Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

BIRC7

DescriptionBaculoviral IAP repeat-containing protein 7

Gene and Protein Information

Gene ID79444
Uniprot Accession IDs Q9BQV0 Q9H2A8 Q9HAP7
Ensembl ID ENSP00000217169
Symbol KIAP LIVIN MLIAP RNF50 KIAP LIVIN MLIAP RNF50 ML-IAP
FamilyBelongs to the IAP family.
Sequence
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp746160BIRC7baculoviral IAP repeat containing 79598VGNC:13833OMA, EggNOG
Macaque697671BIRC7baculoviral IAP repeat containing 79544Inparanoid, OMA, EggNOG
Mouse329581Birc7baculoviral IAP repeat-containing 7 (livin)10090MGI:2676458Inparanoid, OMA, EggNOG
Rat296468Birc7baculoviral IAP repeat-containing 710116RGD:1562883Inparanoid, OMA
Dog485969BIRC7baculoviral IAP repeat containing 79615VGNC:38463Inparanoid, OMA, EggNOG
Horse100147373BIRC7baculoviral IAP repeat containing 79796VGNC:15835Inparanoid, OMA, EggNOG
Cow514508BIRC7baculoviral IAP repeat containing 79913VGNC:26503Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    protease inhibitor    /    Baculoviral IAP repeat-containing protein 7
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Baculoviral IAP repeat-containing protein 7

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Kasof, G M GM and Gomes, B C BC. 2001-02-02 Livin, a novel inhibitor of apoptosis protein family member. [PMID:11024045]
      2.Vucic, D D, Stennicke, H R HR, Pisabarro, M T MT, Salvesen, G S GS and Dixit, V M VM. 2000-11-02 ML-IAP, a novel inhibitor of apoptosis that is preferentially expressed in human melanomas. [PMID:11084335]
      3.Lin, J H JH, Deng, G G, Huang, Q Q and Morser, J J. 2000-12-29 KIAP, a novel member of the inhibitor of apoptosis protein family. [PMID:11162435]
      4.Ashhab, Y Y, Alian, A A, Polliack, A A, Panet, A A and Ben Yehuda, D D. 2001-04-20 Two splicing variants of a new inhibitor of apoptosis gene with different biological properties and tissue distribution pattern. [PMID:11322947]
      5.Deloukas, P P and 126 more authors. 2001 The DNA sequence and comparative analysis of human chromosome 20. [PMID:11780052]
      6.Vucic, Domagoj D and 6 more authors. 2002-04-05 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). [PMID:11801603]
      7.Sanna, M Germana MG and 7 more authors. 2002-03 IAP suppression of apoptosis involves distinct mechanisms: the TAK1/JNK1 signaling cascade and caspase inhibition. [PMID:11865055]
      8.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      9.Gazzaniga, P P and 8 more authors. 2003-01 Expression and prognostic significance of LIVIN, SURVIVIN and other apoptosis-related genes in the progression of superficial bladder cancer. [PMID:12488298]
      10.Clark, Hilary F HF and 51 more authors. 2003-10 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [PMID:12975309]