The store will not work correctly when cookies are disabled.
BAD
| Description | Bcl2-associated agonist of cell death |
|---|
Gene and Protein Information
| Gene ID | 572 |
|---|
| Uniprot Accession IDs | O14803 Q6FH21 BAD |
|---|
| Ensembl ID | ENSP00000378040 |
|---|
| Symbol | BBC6 BCL2L8 BBC2 BCL2L8 |
|---|
| Family | Belongs to the Bcl-2 family. |
|---|
| Sequence | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 100615623 | BAD | BCL2 associated agonist of cell death | 9598 | VGNC:1614 | OMA, EggNOG |
| Macaque | 717740 | BAD | BCL2 associated agonist of cell death | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12015 | Bad | BCL2-associated agonist of cell death | 10090 | MGI:1096330 | Inparanoid, OMA, EggNOG |
| Rat | 64639 | Bad | BCL2-associated agonist of cell death | 10116 | RGD:620103 | Inparanoid, OMA |
| Dog | 483763 | BAD | BCL2 associated agonist of cell death | 9615 | VGNC:38362 | Inparanoid, OMA, EggNOG |
| Horse | 100055447 | BAD | BCL2 associated agonist of cell death | 9796 | VGNC:15752 | Inparanoid, OMA, EggNOG |
| Cow | 615013 | BAD | BCL2 associated agonist of cell death | 9913 | VGNC:26404 | Inparanoid, OMA, EggNOG |
| Pig | 100521065 | BAD | BCL2 associated agonist of cell death | 9823 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
