The store will not work correctly when cookies are disabled.
Protein or Target Summary
Bcl2-associated agonist of cell death
| Gene ID | 572 |
|---|
| uniprot | Q92934 |
|---|
| Gene Name | BAD |
|---|
| Ensernbl ID | ENSP00000378040 |
|---|
| Family | Belongs to the Bcl-2 family. |
|---|
| Sequence | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 572 | BAD | Bcl2-associated agonist of cell death | Q92934 |
| MOUSE | | Bad | Uncharacterized protein | Q3TFU7 |
| MOUSE | | Bad | Bcl2-associated agonist of cell death | D3YZR8 |
| MOUSE | | Bad | Bcl2-associated agonist of cell death | F7ABX5 |
| MOUSE | | Bad | Bcl2-associated agonist of cell death | F6S493 |
| MOUSE | 12015 | Bad | Bcl-associated death promoter, isoform CRA_a | Q3U9H3 |
| MOUSE | 12015 | Bad | Bcl2-associated agonist of cell death | Q61337 |
| RAT | | Bad | Bad protein | Q6P7C5 |
| RAT | 64639 | Bad | Bcl2-associated agonist of cell death | O35147 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
