Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

COX4I1

DescriptionCytochrome c oxidase subunit 4 isoform 1, mitochondrial

Gene and Protein Information

Gene ID1327
Uniprot Accession IDs P13073 B2R4J2 D3DUM7 Q6P666
Ensembl ID ENSP00000457513
Symbol COX4 COX4 COXIV COX4-1 COXIV-1 COX IV-1
FamilyBelongs to the cytochrome c oxidase IV family.
Sequence
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp454391COX4I1cytochrome c oxidase subunit 4I19598VGNC:9043OMA, EggNOG
Macaque693811COX4I1cytochrome c oxidase subunit IV isoform 19544OMA, EggNOG
Mouse12857Cox4i1cytochrome c oxidase subunit 4I110090MGI:88473Inparanoid, OMA, EggNOG
Rat29445Cox4i1cytochrome c oxidase subunit 4i110116RGD:68374Inparanoid, OMA, EggNOG
Dog479623COX4I1cytochrome c oxidase subunit 4I19615VGNC:39539Inparanoid, OMA, EggNOG
Horse100056171COX4I1cytochrome c oxidase subunit 4I19796VGNC:16801Inparanoid, OMA, EggNOG
Cow281090COX4I1cytochrome c oxidase subunit 4I19913VGNC:27634Inparanoid, OMA, EggNOG
Pig100624067LOC100624067cytochrome c oxidase subunit 4 isoform 1, mitochondrial9823Inparanoid, OMA, EggNOG
Platypus100076685LOC100076685cytochrome c oxidase subunit 4 isoform 1, mitochondrial9258OMA, EggNOG
Chicken415826COX4I1cytochrome c oxidase subunit 4I19031CGNC:4285Inparanoid, OMA
Anole lizard100552415LOC100552415cytochrome c oxidase subunit 4 isoform 1, mitochondrial28377OMA, EggNOG
Xenopus549233cox4i1cytochrome c oxidase subunit IV isoform 18364XB-GENE-953648Inparanoid, OMA, EggNOG
Zebrafish326975cox4i1cytochrome c oxidase subunit IV isoform 17955ZDB-GENE-030131-5175Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details
Recombinant Human COX IV ProteinE. coliN-His & MBP
Out of Stock
Expand

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      atypical teratoid / rhabdoid tumor5491Expression AtlasMONDO:0020560
      glioblastoma5998Expression AtlasMONDO:0018177
      medulloblastoma, large-cell6269Expression AtlasMONDO:0002791
      osteosarcoma7970Expression AtlasMONDO:0009807
      ovarian cancer8576Expression AtlasMONDO:0008170
      psoriasis6696Expression AtlasMONDO:0005083
      tuberculosis and treatment for 6 months2482Expression AtlasMONDO:0018076
      Mitochondrial Diseases0DisGeNET
      Chronic lymphocytic leukemia0JensenLab Experiment TIGA

      Bibliography

      1.Bachman, N J NJ, Wu, W W, Schmidt, T R TR, Grossman, L I LI and Lomax, M I MI. 1999-05 The 5' region of the COX4 gene contains a novel overlapping gene, NOC4. [PMID:10337626]
      2. and Lithgow, T T. 2000-06-30 Targeting of proteins to mitochondria. [PMID:10878243]
      3.Hüttemann, M M, Kadenbach, B B and Grossman, L I LI. 2001-04-04 Mammalian subunit IV isoforms of cytochrome c oxidase. [PMID:11311561]
      4.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      5.Tomarev, Stanislav I SI, Wistow, Graeme G, Raymond, Vincent V, Dubois, Stéphane S and Malyukova, Irina I. 2003-06 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis. [PMID:12766061]
      6.Van Kuilenburg, A B AB and 5 more authors. 1992-02-26 Subunit IV of human cytochrome c oxidase, polymorphism and a putative isoform. [PMID:1311608]
      7.Lomax, M I MI, Hewett-Emmett, D D, Yang, T L TL and Grossman, L I LI. 1992-06-15 Rapid evolution of the human gene for cytochrome c oxidase subunit IV. [PMID:1319058]
      8.Williams, Siôn L SL, Valnot, Isabelle I, Rustin, Pierre P and Taanman, Jan-Willem JW. 2004-02-27 Cytochrome c oxidase subassemblies in fibroblast cultures from patients carrying mutations in COX10, SCO1, or SURF1. [PMID:14607829]
      9.Brandenberger, Ralph R and 13 more authors. 2004-06 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation. [PMID:15146197]
      10.Suzuki, Yutaka Y and 7 more authors. 2004-09 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. [PMID:15342556]