The store will not work correctly when cookies are disabled.
Protein or Target Summary
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
| Gene ID | 1327 |
|---|
| uniprot | P13073 |
|---|
| Gene Name | COX4I1 |
|---|
| Ensernbl ID | ENSP00000457513 |
|---|
| Family | Belongs to the cytochrome c oxidase IV family. |
|---|
| Sequence | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1327 | COX4I1 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | P13073 |
| MOUSE | | Cox4i1 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | M0QWX7 |
| MOUSE | | Cox4i1 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | M0QWX2 |
| MOUSE | 12857 | Cox4i1 | Cytochrome c oxidase subunit IV isoform 1 | A2RSV8 |
| MOUSE | 12857 | Cox4i1 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | P19783 |
| RAT | 29445 | Cox4i1 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | P10888 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
