The store will not work correctly when cookies are disabled.
COX4I1
| Description | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 1327 |
|---|
| Uniprot Accession IDs | B2R4J2 D3DUM7 Q6P666 |
|---|
| Ensembl ID | ENSP00000457513 |
|---|
| Symbol | COX4 COX4 COXIV COX4-1 COXIV-1 COX IV-1 |
|---|
| Family | Belongs to the cytochrome c oxidase IV family. |
|---|
| Sequence | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 454391 | COX4I1 | cytochrome c oxidase subunit 4I1 | 9598 | VGNC:9043 | OMA, EggNOG |
| Macaque | 693811 | COX4I1 | cytochrome c oxidase subunit IV isoform 1 | 9544 | | OMA, EggNOG |
| Mouse | 12857 | Cox4i1 | cytochrome c oxidase subunit 4I1 | 10090 | MGI:88473 | Inparanoid, OMA, EggNOG |
| Rat | 29445 | Cox4i1 | cytochrome c oxidase subunit 4i1 | 10116 | RGD:68374 | Inparanoid, OMA, EggNOG |
| Dog | 479623 | COX4I1 | cytochrome c oxidase subunit 4I1 | 9615 | VGNC:39539 | Inparanoid, OMA, EggNOG |
| Horse | 100056171 | COX4I1 | cytochrome c oxidase subunit 4I1 | 9796 | VGNC:16801 | Inparanoid, OMA, EggNOG |
| Cow | 281090 | COX4I1 | cytochrome c oxidase subunit 4I1 | 9913 | VGNC:27634 | Inparanoid, OMA, EggNOG |
| Pig | 100624067 | LOC100624067 | cytochrome c oxidase subunit 4 isoform 1, mitochondrial | 9823 | | Inparanoid, OMA, EggNOG |
| Platypus | 100076685 | LOC100076685 | cytochrome c oxidase subunit 4 isoform 1, mitochondrial | 9258 | | OMA, EggNOG |
| Chicken | 415826 | COX4I1 | cytochrome c oxidase subunit 4I1 | 9031 | CGNC:4285 | Inparanoid, OMA |
| Anole lizard | 100552415 | LOC100552415 | cytochrome c oxidase subunit 4 isoform 1, mitochondrial | 28377 | | OMA, EggNOG |
| Xenopus | 549233 | cox4i1 | cytochrome c oxidase subunit IV isoform 1 | 8364 | XB-GENE-953648 | Inparanoid, OMA, EggNOG |
| Zebrafish | 326975 | cox4i1 | cytochrome c oxidase subunit IV isoform 1 | 7955 | ZDB-GENE-030131-5175 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
