JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Apoptosis regulator Bcl-2

Gene ID	596
uniprot	P10415
Gene Name	BCL2
Ensernbl ID	ENSP00000381185
Family	Belongs to the Bcl-2 family.
Sequence	MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	596	BCL2	Apoptosis regulator Bcl-2	P10415
MOUSE	12043	Bcl2	Uncharacterized protein	Q8BQK4
MOUSE	12043	Bcl2	B-cell leukemia/lymphoma 2	Q6NTH7
MOUSE	12043	Bcl2	Apoptosis regulator Bcl-2	P10417
RAT		Bcl2	Apoptosis regulator Bcl-2	F1LNV0
RAT		Bcl2	Apoptosis regulator Bcl-2	A0A1B0GWM8
RAT	24224	Bcl2	Apoptosis regulator Bcl-2	P49950

Protein Classes

PANTHER Classes
protein / signaling molecule / Apoptosis regulator Bcl-2

DTO Classes
protein / Signaling / Apoptosis regulator Bcl-2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx