Protein or Target Summary

Homeobox protein DLX-6

Gene ID	1750
uniprot	P56179
Gene Name	DLX6
Ensernbl ID	ENSP00000428480
Family	Belongs to the distal-less homeobox family.
Sequence	MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1750	DLX6	Homeobox protein DLX-6	P56179
MOUSE	13396	Dlx6	Homeobox protein DLX-6	P70397
MOUSE		Dlx6	Truncated transcription factor Dlx6	A5HKN3
MOUSE		Dlx6	Homeobox protein DLX-6	A0A0R4J0C1
RAT		Dlx6	Similar to Homeobox protein DLX-6 (Predicted)	A0A096MIY0

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein DLX-6
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein DLX-6

DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein DLX-6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx