The store will not work correctly when cookies are disabled.
BAX
| Description | Apoptosis regulator BAX |
|---|
Gene and Protein Information
| Gene ID | 581 |
|---|
| Uniprot Accession IDs | A8K4W1 P55269 Q07814 Q07815 Q8WZ49 Q9NR76 Q9NYG7 Q9UCZ6 Q9UCZ7 Q9UQD6 |
|---|
| Ensembl ID | ENSP00000293288 |
|---|
| Symbol | BCL2L4 BCL2L4 |
|---|
| Family | Belongs to the Bcl-2 family. |
|---|
| Sequence | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 747093 | BAX | BCL2 associated X, apoptosis regulator | 9598 | VGNC:10275 | OMA, EggNOG |
| Macaque | 718948 | BAX | BCL2 associated X, apoptosis regulator | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12028 | Bax | BCL2-associated X protein | 10090 | MGI:99702 | Inparanoid, OMA, EggNOG |
| Rat | 24887 | Bax | BCL2 associated X, apoptosis regulator | 10116 | RGD:2192 | Inparanoid, OMA, EggNOG |
| Dog | 403523 | BAX | BCL2 associated X, apoptosis regulator | 9615 | VGNC:38388 | Inparanoid, OMA, EggNOG |
| Horse | 100054674 | BAX | BCL2 associated X, apoptosis regulator | 9796 | VGNC:50999 | Inparanoid, OMA, EggNOG |
| Cow | 280730 | BAX | BCL2 associated X, apoptosis regulator | 9913 | VGNC:26428 | Inparanoid, OMA, EggNOG |
| Pig | 396633 | BAX | BCL2 associated X, apoptosis regulator | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100030412 | BAX | BCL2 associated X, apoptosis regulator | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100561911 | LOC100561911 | apoptosis regulator BAX | 28377 | | OMA, EggNOG |
| Xenopus | 394793 | bax | BCL2-associated X protein | 8364 | XB-GENE-486067 | Inparanoid, OMA, EggNOG |
| Zebrafish | 58081 | baxa | BCL2 associated X, apoptosis regulator a | 7955 | ZDB-GENE-000511-6 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes protein /
Signaling / Apoptosis regulator BAX
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
