Protein or Target Summary

Brain-derived neurotrophic factor

Gene ID	627
uniprot	P23560
Gene Name	BDNF
Ensernbl ID	ENSP00000414303
Family	Belongs to the NGF-beta family.
Sequence	MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	627	BDNF	Brain-derived neurotrophic factor	P23560
MOUSE		Bdnf	Brain-derived neurotrophic factor	Q8CCH9
MOUSE		Bdnf	Brain-derived neurotrophic factor transcript variant 5	E2IUB1
MOUSE	12064	Bdnf	Brain-derived neurotrophic factor	A2AII2
MOUSE		Bdnf	Brain-derived neurotrophic factor	H9H9S8
MOUSE		BDNF	Brain-derived neurotrophic factor	A0A1B4Z9M7
MOUSE		BDNF	Brain-derived neurotrophic factor	Q99NV8
MOUSE	12064	Bdnf	Brain-derived neurotrophic factor	Q541P3
MOUSE	12064	Bdnf	Brain-derived neurotrophic factor	P21237
RAT	24225	Bdnf	Brain-derived neurotrophic factor	A0A0H2UI28
RAT		BDNF	Brain-derived neurotrophic factor	Q99NV7
RAT		Bdnf	Brain-derived neurotrophic factor	C8CEB1
RAT	24225	Bdnf	Brain-derived neurotrophic factor	A0A0G2K624
RAT	24225	Bdnf	Brain-derived neurotrophic factor	P23363

PANTHER Classes
protein / growth factor / neurotrophic factor / Brain-derived neurotrophic factor

DTO Classes
protein / Signaling / Growth factor / Neurotrophic factor / Brain-derived neurotrophic factor

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source