The store will not work correctly when cookies are disabled.
BDNF
| Description | Brain-derived neurotrophic factor |
|---|
Gene and Protein Information
| Gene ID | 627 |
|---|
| Uniprot Accession IDs | A7LA85 A7LA92 D3DQZ2 Q598Q1 Q6DN19 Q6YNR2 Q6YNR3 Q9BYY7 Q9UC24 BDNF |
|---|
| Ensembl ID | ENSP00000414303 |
|---|
| Symbol | ANON2 BULN2 |
|---|
| Family | Belongs to the NGF-beta family. |
|---|
| Sequence | MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 503511 | BDNF | brain derived neurotrophic factor | 9598 | VGNC:11265 | Inparanoid, OMA |
| Macaque | 701245 | BDNF | brain derived neurotrophic factor | 9544 | | OMA, EggNOG |
| Mouse | 12064 | Bdnf | brain derived neurotrophic factor | 10090 | MGI:88145 | Inparanoid, OMA, EggNOG |
| Rat | 24225 | Bdnf | brain-derived neurotrophic factor | 10116 | RGD:2202 | Inparanoid, OMA, EggNOG |
| Dog | | BDNF | brain derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:1033] | 9615 | | OMA, EggNOG |
| Horse | 100009689 | BDNF | brain derived neurotrophic factor | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 617701 | BDNF | brain derived neurotrophic factor | 9913 | VGNC:26461 | Inparanoid, OMA, EggNOG |
| Pig | 397495 | BDNF | brain derived neurotrophic factor | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | BDNF | brain derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:1033] | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 396186 | BDNF | brain derived neurotrophic factor | 9031 | CGNC:9230 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564408 | bdnf | brain derived neurotrophic factor | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100037853 | bdnf | brain-derived neurotrophic factor | 8364 | XB-GENE-955554 | Inparanoid, OMA, EggNOG |
| Zebrafish | 58118 | bdnf | brain-derived neurotrophic factor | 7955 | ZDB-GENE-000412-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
