JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Corticotropin-releasing factor-binding protein

Gene ID	1393
uniprot	P24387
Gene Name	CRHBP
Ensernbl ID	ENSP00000274368
Family	Belongs to the CRF-binding protein family.
Sequence	MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1393	CRHBP	Corticotropin-releasing factor-binding protein	P24387
MOUSE		Crhbp	Corticotropin-releasing factor-binding protein	A0A217FL62
MOUSE		Crhbp	Uncharacterized protein	Q3TPS3
MOUSE	12919	Crhbp	Corticotropin-releasing factor-binding protein	Q3UY07
MOUSE	12919	Crhbp	Corticotropin-releasing factor-binding protein	Q60571
RAT	29625	Crhbp	Corticotropin-releasing factor-binding protein	O35761
RAT		Crhbp	Corticotropin-releasing factor-binding protein	P24388

Protein Classes

PANTHER Classes
protein / signaling molecule / Corticotropin-releasing factor-binding protein

DTO Classes
protein / Signaling / Corticotropin-releasing factor-binding protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx