The store will not work correctly when cookies are disabled.
Protein or Target Summary
Dual specificity phosphatase DUPD1
| Gene ID | 338599 |
|---|
| uniprot | Q68J44 |
|---|
| Gene Name | DUPD1 |
|---|
| Ensernbl ID | ENSP00000340609 |
|---|
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. |
|---|
| Sequence | MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 338599 | DUPD1 | Dual specificity phosphatase DUPD1 | Q68J44 |
| MOUSE | 435391 | Dupd1 | Dual specificity phosphatase DUPD1 | Q8BK84 |
| MOUSE | | Dupd1 | Dual-specificity phosphatase DUPD1 | A0A286YD16 |
| RAT | 361003 | Dupd1 | Dual specificity phosphatase DUPD1 | P0C595 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
