JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Bcl-2-related protein A1

Gene ID	597
uniprot	Q16548
Gene Name	BCL2A1
Ensernbl ID	ENSP00000267953
Family	Belongs to the Bcl-2 family.
Sequence	MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	597	BCL2A1	Bcl-2-related protein A1	Q16548
MOUSE	12044	Bcl2a1	Bcl-2-related protein A1	Q07440
RAT		Bcl2a1	B-cell leukemia/lymphoma 2 related protein A1	G3V977
RAT	170929	Bcl2a1	BCL2-related protein A1	Q925A9

Protein Classes

PANTHER Classes
protein / signaling molecule / Bcl-2-related protein A1

DTO Classes
protein / Signaling / Bcl-2-related protein A1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx