Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Egl nine homolog 3

Gene ID112399
uniprotQ9H6Z9
Gene NameEGLN3
Ensernbl IDENSP00000250457
Sequence
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN112399EGLN3Egl nine homolog 3Q9H6Z9
MOUSE112407Egln3Egl nine homolog 3Q91UZ4
MOUSE112407Egln3EGL nine homolog 3 (C. elegans)A0A0R4J0H9
RAT54702Egln3Egl nine homolog 3Q62630
RATEgln3Egl nine homolog 3G3V6N9

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.