JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

ATP-dependent Clp protease proteolytic subunit, mitochondrial

Gene ID	8192
uniprot	Q16740
Gene Name	CLPP
Ensernbl ID	ENSP00000245816
Family	Belongs to the peptidase S14 family.
Sequence	MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	8192	CLPP	ATP-dependent Clp protease proteolytic subunit, mitochondrial	Q16740
MOUSE		Clpp	ATP-dependent Clp protease proteolytic subunit	Q8CF81
MOUSE		Clpp	ATP-dependent Clp protease proteolytic subunit	Q3UGW4
MOUSE	53895	Clpp	ATP-dependent Clp protease proteolytic subunit, mitochondrial	O88696
RAT		Clpp	ATP-dependent Clp protease proteolytic subunit	M0RAD5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx