Protein or Target Summary
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
Gene ID | 1438 |
---|---|
uniprot | P15509 |
Gene Name | CSF2RA |
Ensernbl ID | ENSP00000394227 |
Family | Belongs to the type I cytokine receptor family. Type 5 subfamily. |
Sequence | MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 1438 | CSF2RA | Granulocyte-macrophage colony-stimulating factor receptor subunit alpha | P15509 |
MOUSE | 12982 | Csf2ra | Granulocyte-macrophage colony-stimulating factor receptor subunit alpha | Q00941 |
MOUSE | Csf2ra | Granulocyte-macrophage colony-stimulating factor receptor alpha-chain truncated isoform | A9P558 | |
MOUSE | Csf2ra | Granulocyte-macrophage colony-stimulating factor receptor alpha-chain deletion isoform | A9P557 | |
MOUSE | Csf2ra | Colony stimulating factor 2 receptor, alpha, low-affinity (Granulocyte-macrophage) | B2RWT6 | |
RAT | Csf2ra | Colony-stimulating factor 2 receptor alpha subunit | M0R536 | |
RAT | 652957 | Csf2ra | Granulocyte-macrophage colony stimulating receptor alpha | Q701L2 |
RAT | Csf2ra | Colony-stimulating factor 2 receptor alpha subunit | A0A0G2KAL6 |
Protein Classes
PANTHER Classes
protein / signaling molecule / defense/immunity protein / Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
protein / signaling molecule / cytokine / Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
protein / signaling molecule / defense/immunity protein / Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
protein / signaling molecule / cytokine / Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx