Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

Gene ID1438
uniprotP15509
Gene NameCSF2RA
Ensernbl IDENSP00000394227
FamilyBelongs to the type I cytokine receptor family. Type 5 subfamily.
Sequence
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN1438CSF2RAGranulocyte-macrophage colony-stimulating factor receptor subunit alphaP15509
MOUSE12982Csf2raGranulocyte-macrophage colony-stimulating factor receptor subunit alphaQ00941
MOUSECsf2raGranulocyte-macrophage colony-stimulating factor receptor alpha-chain truncated isoformA9P558
MOUSECsf2raGranulocyte-macrophage colony-stimulating factor receptor alpha-chain deletion isoformA9P557
MOUSECsf2raColony stimulating factor 2 receptor, alpha, low-affinity (Granulocyte-macrophage)B2RWT6
RATCsf2raColony-stimulating factor 2 receptor alpha subunitM0R536
RAT652957Csf2raGranulocyte-macrophage colony stimulating receptor alphaQ701L2
RATCsf2raColony-stimulating factor 2 receptor alpha subunitA0A0G2KAL6

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    defense/immunity protein    /    Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
protein    /    signaling molecule    /    cytokine    /    Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
DTO Classes
protein    /    Signaling    /    Cytokine    /    Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source