JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

CMA1

Description	Chymase

Gene and Protein Information

Gene ID	1215
Uniprot Accession IDs	B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5
Ensembl ID	ENSP00000250378
Symbol	CYH CYM CYH MCT1 chymase
Family	Belongs to the peptidase S1 family. Granzyme subfamily.
Sequence	MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	745533	CMA1	chymase 1	9598	VGNC:8197	OMA, EggNOG
Macaque	716395	CMA1	chymase 1	9544		Inparanoid, OMA, EggNOG
Mouse	17228	Cma1	chymase 1, mast cell	10090	MGI:96941	Inparanoid, OMA, EggNOG
Rat	25627	Cma1	chymase 1	10116	RGD:2365	Inparanoid, OMA, EggNOG
Dog	490628	CMA1	chymase 1	9615	VGNC:49768	Inparanoid, OMA, EggNOG
Cow	540321	LOC540321	mast cell protease 2	9913		Inparanoid, OMA
Cow	100139881	LOC100139881	mast cell protease 2	9913		OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    serine protease    /    Chymase
protein    /    protease    /    Chymase
protein    /    hydrolase    /    Chymase

DTO Classes
protein / Enzyme / Protease / Serine protease / Chymase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]