The store will not work correctly when cookies are disabled.
BCL2L2
Description | Bcl-2-like protein 2 |
---|
Gene and Protein Information
Gene ID | 599 |
Uniprot Accession IDs | A8K0F4 Q2M3U0 Q5U0H4 Bcl2-L-2 |
Ensembl ID | ENSP00000250405 |
Symbol | BCLW KIAA0271 BCLW BCL-W PPP1R51 BCL2-L-2 |
Family | Belongs to the Bcl-2 family. |
Sequence | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 100611631 | BCL2L2 | BCL2 like 2 | 9598 | VGNC:12984 | OMA, EggNOG |
Mouse | 12050 | Bcl2l2 | BCL2-like 2 | 10090 | MGI:108052 | Inparanoid, OMA, EggNOG |
Rat | 60434 | Bcl2l2 | Bcl2-like 2 | 10116 | RGD:620717 | Inparanoid, OMA, EggNOG |
Dog | 490611 | BCL2L2 | BCL2 like 2 | 9615 | | Inparanoid, OMA |
Horse | 100055644 | BCL2L2 | BCL2 like 2 | 9796 | VGNC:50577 | Inparanoid, OMA, EggNOG |
Cow | 767601 | BCL2L2 | BCL2 like 2 | 9913 | | Inparanoid, OMA |
Xenopus | 496475 | bcl2l2 | BCL2-like 2 | 8364 | XB-GENE-992427 | Inparanoid, OMA |
Protein Classes
DTO Classes protein /
Signaling / Bcl-2-like protein 2
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|