JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Bcl-2-like protein 2

Gene ID	599
uniprot	Q92843
Gene Name	BCL2L2
Ensernbl ID	ENSP00000250405
Family	Belongs to the Bcl-2 family.
Sequence	MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	599	BCL2L2	Bcl-2-like protein 2	Q92843
MOUSE		Bcl2l2	Uncharacterized protein	Q9D1Y5
MOUSE		Bcl2l2	Bcl-2-like protein 2	G3XA70
MOUSE		Bcl2l2	Bcl-2-like protein 2	A0A2I3BR11
MOUSE	12050	Bcl2l2	Bcl-2-like protein 2	P70345
RAT	60434	Bcl2l2	Bcl-W	O88996
RAT	60434	Bcl2l2	BCL-WEL	Q7TS60

Protein Classes

PANTHER Classes
protein / signaling molecule / Bcl-2-like protein 2

DTO Classes
protein / Signaling / Bcl-2-like protein 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx