JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Bcl-2-like protein 10

Gene ID	10017
uniprot	Q9HD36
Gene Name	BCL2L10
Ensernbl ID	ENSP00000260442
Family	Belongs to the Bcl-2 family.
Sequence	MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10017	BCL2L10	Bcl-2-like protein 10	Q9HD36
MOUSE	12049	Bcl2l10	Bcl-2-like protein 10	Q9Z0F3
RAT	114552	Bcl2l10	Bcl-2-like protein 10	Q99M66

Protein Classes

PANTHER Classes
protein / signaling molecule / Bcl-2-like protein 10

DTO Classes
protein / Signaling / Bcl-2-like protein 10

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx