The store will not work correctly when cookies are disabled.
Protein or Target Summary
Bcl-2-like protein 10
Gene ID | 10017 |
uniprot | Q9HD36 |
Gene Name | BCL2L10 |
Ensernbl ID | ENSP00000260442 |
Family | Belongs to the Bcl-2 family. |
Sequence | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 10017 | BCL2L10 | Bcl-2-like protein 10 | Q9HD36 |
MOUSE | 12049 | Bcl2l10 | Bcl-2-like protein 10 | Q9Z0F3 |
RAT | 114552 | Bcl2l10 | Bcl-2-like protein 10 | Q99M66 |
Protein Classes
DTO Classes protein /
Signaling / Bcl-2-like protein 10
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|