Protein or Target Summary

COUP transcription factor 2

Gene ID	7026
uniprot	P24468
Gene Name	NR2F2
Ensernbl ID	ENSP00000377721
Family	Belongs to the nuclear hormone receptor family. NR2 subfamily.
Sequence	MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7026	NR2F2	COUP transcription factor 2	P24468
MOUSE		Nr2f2	COUP transcription factor 2	A0A140LJF1
MOUSE	11819	Nr2f2	Uncharacterized protein	Q3UST6
MOUSE	11819	Nr2f2	COUP transcription factor 2	D3YYP4
MOUSE	11819	Nr2f2	COUP transcription factor 2	P43135
RAT	113984	Nr2f2	COUP transcription factor 2	A0A0G2K1W0
RAT	113984	Nr2f2	COUP transcription factor 2	O09018

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    Coup transcription factor 2
protein    /    receptor    /    Coup transcription factor 2
protein    /    nucleic acid binding    /    Coup transcription factor 2
protein    /    C4 zinc finger nuclear receptor    /    Coup transcription factor 2

DTO Classes
protein / Nuclear receptor / COUP-TF-like receptors / Coup transcription factor 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx