The store will not work correctly when cookies are disabled.
CDK6
Description | Cyclin-dependent kinase 6 |
---|
Gene and Protein Information
Gene ID | 1021 |
Uniprot Accession IDs | A4D1G0 |
Ensembl ID | ENSP00000265734 |
Symbol | CDKN6 MCPH12 PLSTIRE |
Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
Sequence | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 746968 | CDK6 | cyclin dependent kinase 6 | 9598 | VGNC:13637 | OMA, EggNOG |
Macaque | 701822 | CDK6 | cyclin dependent kinase 6 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 12571 | Cdk6 | cyclin-dependent kinase 6 | 10090 | MGI:1277162 | Inparanoid, OMA, EggNOG |
Rat | 114483 | Cdk6 | cyclin-dependent kinase 6 | 10116 | RGD:621121 | Inparanoid, OMA, EggNOG |
Dog | 609920 | CDK6 | cyclin dependent kinase 6 | 9615 | VGNC:54756 | Inparanoid, OMA |
Horse | 100061625 | CDK6 | cyclin dependent kinase 6 | 9796 | VGNC:16354 | Inparanoid, OMA |
Cow | 511754 | CDK6 | cyclin dependent kinase 6 | 9913 | VGNC:27133 | Inparanoid, OMA |
Opossum | 100021675 | CDK6 | cyclin dependent kinase 6 | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 420558 | CDK6 | cyclin dependent kinase 6 | 9031 | CGNC:51286 | Inparanoid, OMA, EggNOG |
Anole lizard | 100558412 | cdk6 | cyclin dependent kinase 6 | 28377 | | Inparanoid, OMA |
Xenopus | | cdk6 | cyclin-dependent kinase 6 [Source:Xenbase;Acc:XB-GENE-985427] | 8364 | | OMA, EggNOG |
Zebrafish | 100034507 | cdk6 | cyclin-dependent kinase 6 | 7955 | ZDB-GENE-060503-786 | Inparanoid, OMA |
C. elegans | 181472 | cdk-4 | Cyclin-dependent kinase 4 homolog | 6239 | | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|