| Description | Cyclin-dependent kinase 6 |
|---|
Gene and Protein Information
| Gene ID | 1021 |
|---|---|
| Uniprot Accession IDs | A4D1G0 |
| Ensembl ID | ENSP00000265734 |
| Symbol | CDKN6 MCPH12 PLSTIRE |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746968 | CDK6 | cyclin dependent kinase 6 | 9598 | VGNC:13637 | OMA, EggNOG |
| Macaque | 701822 | CDK6 | cyclin dependent kinase 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12571 | Cdk6 | cyclin-dependent kinase 6 | 10090 | MGI:1277162 | Inparanoid, OMA, EggNOG |
| Rat | 114483 | Cdk6 | cyclin-dependent kinase 6 | 10116 | RGD:621121 | Inparanoid, OMA, EggNOG |
| Dog | 609920 | CDK6 | cyclin dependent kinase 6 | 9615 | VGNC:54756 | Inparanoid, OMA |
| Horse | 100061625 | CDK6 | cyclin dependent kinase 6 | 9796 | VGNC:16354 | Inparanoid, OMA |
| Cow | 511754 | CDK6 | cyclin dependent kinase 6 | 9913 | VGNC:27133 | Inparanoid, OMA |
| Opossum | 100021675 | CDK6 | cyclin dependent kinase 6 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 420558 | CDK6 | cyclin dependent kinase 6 | 9031 | CGNC:51286 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558412 | cdk6 | cyclin dependent kinase 6 | 28377 | Inparanoid, OMA | |
| Xenopus | cdk6 | cyclin-dependent kinase 6 [Source:Xenbase;Acc:XB-GENE-985427] | 8364 | OMA, EggNOG | ||
| Zebrafish | 100034507 | cdk6 | cyclin-dependent kinase 6 | 7955 | ZDB-GENE-060503-786 | Inparanoid, OMA |
| C. elegans | 181472 | cdk-4 | Cyclin-dependent kinase 4 homolog | 6239 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 6
protein / protein kinase / Cyclin-dependent kinase 6
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 6
protein / transferase / Cyclin-dependent kinase 6
protein / kinase / Cyclin-dependent kinase 6
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 6
protein / protein kinase / Cyclin-dependent kinase 6
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 6
protein / transferase / Cyclin-dependent kinase 6
protein / kinase / Cyclin-dependent kinase 6
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK4 subfamily / Cyclin-dependent kinase 6
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK4 subfamily / Cyclin-dependent kinase 6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|