Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
྾

CDK6

DescriptionCyclin-dependent kinase 6

Gene and Protein Information

Gene ID1021
Uniprot Accession IDs Q00534 A4D1G0
Ensembl ID ENSP00000265734
Symbol CDKN6 MCPH12 PLSTIRE
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp746968CDK6cyclin dependent kinase 69598VGNC:13637OMA, EggNOG
Macaque701822CDK6cyclin dependent kinase 69544Inparanoid, OMA, EggNOG
Mouse12571Cdk6cyclin-dependent kinase 610090MGI:1277162Inparanoid, OMA, EggNOG
Rat114483Cdk6cyclin-dependent kinase 610116RGD:621121Inparanoid, OMA, EggNOG
Dog609920CDK6cyclin dependent kinase 69615VGNC:54756Inparanoid, OMA
Horse100061625CDK6cyclin dependent kinase 69796VGNC:16354Inparanoid, OMA
Cow511754CDK6cyclin dependent kinase 69913VGNC:27133Inparanoid, OMA
Opossum100021675CDK6cyclin dependent kinase 613616Inparanoid, OMA, EggNOG
Chicken420558CDK6cyclin dependent kinase 69031CGNC:51286Inparanoid, OMA, EggNOG
Anole lizard100558412cdk6cyclin dependent kinase 628377Inparanoid, OMA
Xenopuscdk6cyclin-dependent kinase 6 [Source:Xenbase;Acc:XB-GENE-985427]8364OMA, EggNOG
Zebrafish100034507cdk6cyclin-dependent kinase 67955ZDB-GENE-060503-786Inparanoid, OMA
C. elegans181472cdk-4Cyclin-dependent kinase 4 homolog6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    non-receptor serine/threonine protein kinase    /    Cyclin-dependent kinase 6
protein    /    protein kinase    /    Cyclin-dependent kinase 6
protein    /    non-receptor tyrosine protein kinase    /    Cyclin-dependent kinase 6
protein    /    transferase    /    Cyclin-dependent kinase 6
protein    /    kinase    /    Cyclin-dependent kinase 6
DTO Classes
protein    /    Kinase    /    Protein kinase    /    CMGC group    /    CDK family    /    CDK4 subfamily    /    Cyclin-dependent kinase 6

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.