Protein or Target Summary
Cyclin-dependent kinase 6
| Gene ID | 1021 |
|---|---|
| uniprot | Q00534 |
| Gene Name | CDK6 |
| Ensernbl ID | ENSP00000265734 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 1021 | CDK6 | Cyclin-dependent kinase 6 | Q00534 |
| MOUSE | 12571 | Cdk6 | Cyclin-dependent kinase 6 | Q64261 |
| MOUSE | Cdk6 | Cyclin-dependent kinase 6 | A0A0G2JEJ6 | |
| MOUSE | Cdk6 | Cyclin-dependent kinase 6 | A0A0G2JGH2 | |
| MOUSE | Cdk6 | Uncharacterized protein | Q3U4J9 | |
| MOUSE | Cdk6 | Cyclin-dependent kinase 6 | A0A0G2JGA8 | |
| MOUSE | 12571 | Cdk6 | Cyclin-dependent kinase 6 | Q0VBK8 |
| RAT | 114483 | Cdk6 | Cyclin-dependent kinase 6 | F1MA87 |
| RAT | Cdk6 | Cyclin-dependent kinase 6 | Q99MD0 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 6
protein / protein kinase / Cyclin-dependent kinase 6
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 6
protein / transferase / Cyclin-dependent kinase 6
protein / kinase / Cyclin-dependent kinase 6
protein / non-receptor serine/threonine protein kinase / Cyclin-dependent kinase 6
protein / protein kinase / Cyclin-dependent kinase 6
protein / non-receptor tyrosine protein kinase / Cyclin-dependent kinase 6
protein / transferase / Cyclin-dependent kinase 6
protein / kinase / Cyclin-dependent kinase 6
DTO Classes
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK4 subfamily / Cyclin-dependent kinase 6
protein / Kinase / Protein kinase / CMGC group / CDK family / CDK4 subfamily / Cyclin-dependent kinase 6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx