| Description | Chymotrypsin-like elastase family member 1 |
|---|
Gene and Protein Information
| Gene ID | 1990 |
|---|---|
| Uniprot Accession IDs | Q5MLF0 Q6DJT0 Q6ISM6 |
| Ensembl ID | ENSP00000293636 |
| Symbol | ELA1 ELA1 |
| Family | Belongs to the peptidase S1 family. Elastase subfamily. |
| Sequence | MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740437 | CELA1 | chymotrypsin like elastase family member 1 | 9598 | VGNC:5333 | OMA, EggNOG |
| Macaque | 695507 | CELA1 | chymotrypsin like elastase family member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 109901 | Cela1 | chymotrypsin-like elastase family, member 1 | 10090 | MGI:95314 | Inparanoid, OMA, EggNOG |
| Rat | 24331 | Cela1 | chymotrypsin-like elastase family, member 1 | 10116 | RGD:2547 | Inparanoid, OMA, EggNOG |
| Dog | 403515 | CELA1 | chymotrypsin like elastase family member 1 | 9615 | VGNC:39092 | Inparanoid, OMA, EggNOG |
| Horse | 100052672 | CELA1 | chymotrypsin like elastase family member 1 | 9796 | VGNC:16385 | Inparanoid, OMA, EggNOG |
| Cow | 281139 | CELA1 | chymotrypsin like elastase family member 1 | 9913 | VGNC:27166 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567701 | cela1 | chymotrypsin like elastase family member 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 445282 | zgc:92041 | zgc:92041 | 7955 | ZDB-GENE-040808-55 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / serine protease / Chymotrypsin-like elastase family member 1
protein / protease / Chymotrypsin-like elastase family member 1
protein / hydrolase / Chymotrypsin-like elastase family member 1
protein / serine protease / Chymotrypsin-like elastase family member 1
protein / protease / Chymotrypsin-like elastase family member 1
protein / hydrolase / Chymotrypsin-like elastase family member 1
DTO Classes
protein / Enzyme / Protease / Serine protease / Chymotrypsin-like elastase family member 1
protein / Enzyme / Protease / Serine protease / Chymotrypsin-like elastase family member 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|