Protein or Target Summary

Chymotrypsin-like elastase family member 1

Gene ID1990
uniprotQ9UNI1
Gene NameCELA1
Ensernbl IDENSP00000293636
FamilyBelongs to the peptidase S1 family. Elastase subfamily.
Sequence
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN1990CELA1Chymotrypsin-like elastase family member 1Q9UNI1
MOUSE109901Cela1Chymotrypsin-like elastase family member 1Q91X79
MOUSECela1Chymotrypsin-like elastase family member 1A0A2R8VK43
MOUSECela1Uncharacterized proteinQ8CF10
MOUSECela1Chymotrypsin-like elastase family member 1A0A2R8VHA6
MOUSECela1Chymotrypsin-like elastase family member 1A0A2R8VHL3
RAT24331Cela1Chymotrypsin-like elastase family member 1P00773
RAT24331Cela1Chymotrypsin-like elastase family member 1A0A0G2JSI5

Protein Classes

PANTHER Classes
protein    /    serine protease    /    Chymotrypsin-like elastase family member 1
protein    /    protease    /    Chymotrypsin-like elastase family member 1
protein    /    hydrolase    /    Chymotrypsin-like elastase family member 1
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Chymotrypsin-like elastase family member 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source