JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

HLA-DQA1

Description	HLA class II histocompatibility antigen, DQ alpha 1 chain

Gene and Protein Information

Gene ID	3117
Uniprot Accession IDs	O19630 O19706 P01907 P01908 P04225 P04226 P05536 P79553 Q06751 Q29876 Q29994 Q2Q6Y6 Q2Q6Y7 Q2Q6Y8 Q2WCM3 Q30064 Q30067 Q30068 Q30070 Q30071 Q30072 Q30073 Q30086 Q30101 Q5Y7D5 Q5Y7F5 Q6ICU6 Q6PR46 Q6QDB1 Q860W2 Q860W4 Q9BD37 Q9TPM3 Q9UM31
Ensembl ID	ENSP00000339398
Symbol	DQA1 DQ-A1 CELIAC1 HLA-DQA
Family	Belongs to the MHC class II family.
Sequence	MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	14960	H2-Aa	histocompatibility 2, class II antigen A, alpha	10090	MGI:95895	Inparanoid, OMA
Rat	309621	RT1-Ba	RT1 class II, locus Ba	10116	RGD:1595867	Inparanoid, OMA
Horse	100052249	DQA	MHC class II DQ-alpha	9796		Inparanoid, OMA
Pig	100153387	SLA-DQA1	MHC class II histocompatibility antigen SLA-DQA	9823		Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / defense/immunity protein / major histocompatibility complex antigen / HLA class II histocompatibility antigen, DQ alpha 1 chain

DTO Classes
protein / Immune response / Major histocompatibility complex antigen / HLA class II histocompatibility antigen, DQ alpha 1 chain

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]