The store will not work correctly when cookies are disabled.
COMT
| Description | Catechol O-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 1312 |
|---|
| Uniprot Accession IDs | A8MPV9 Q6IB07 Q6ICE6 Q9BWC7 |
|---|
| Ensembl ID | ENSP00000354511 |
|---|
| Symbol | HEL-S-98n |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-dependent O-methyltransferase family. |
|---|
| Sequence | MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 458655 | COMT | catechol-O-methyltransferase | 9598 | VGNC:12831 | OMA, EggNOG |
| Mouse | 12846 | Comt | catechol-O-methyltransferase | 10090 | MGI:88470 | Inparanoid, OMA, EggNOG |
| Rat | 24267 | Comt | catechol-O-methyltransferase | 10116 | RGD:2379 | Inparanoid, OMA, EggNOG |
| Dog | 445450 | COMT | catechol-O-methyltransferase | 9615 | VGNC:39501 | Inparanoid, OMA, EggNOG |
| Pig | 100155530 | COMT | catechol-O-methyltransferase | 9823 | | Inparanoid, OMA, EggNOG |
| Chicken | 416783 | MIR4761 | microRNA 4761 | 9031 | CGNC:1439 | OMA, EggNOG |
| Xenopus | 100135405 | LOC100135405 | uncharacterized LOC100135405 | 8364 | | Inparanoid, OMA |
| Xenopus | 549111 | comt | catechol-O-methyltransferase | 8364 | XB-GENE-948947 | OMA, EggNOG |
| Zebrafish | 561372 | comta | catechol-O-methyltransferase a | 7955 | ZDB-GENE-050913-117 | OMA, EggNOG |
| Zebrafish | 565370 | comtb | catechol-O-methyltransferase b | 7955 | ZDB-GENE-040724-164 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
