JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Catechol O-methyltransferase

Gene ID	1312
uniprot	P21964
Gene Name	COMT
Ensernbl ID	ENSP00000354511
Family	Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-dependent O-methyltransferase family.
Sequence	MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1312	COMT	Catechol O-methyltransferase	P21964
MOUSE		Comt	Catechol O-methyltransferase	D3Z227
MOUSE	12846	Comt	Catechol O-methyltransferase	O88587
RAT	24267	Comt	Catechol-O-methyltransferase	F2W8B0
RAT	24267	Comt	Catechol O-methyltransferase	P22734

Protein Classes

PANTHER Classes
protein / transferase / methyltransferase / Catechol O-methyltransferase

DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Catechol O-methyltransferase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx