The store will not work correctly when cookies are disabled.
PLAU
| Description | Urokinase-type plasminogen activator |
|---|
Gene and Protein Information
| Gene ID | 5328 |
|---|
| Uniprot Accession IDs | B4DPZ2 Q15844 Q16618 Q53XS3 Q5SWW9 Q969W6 U-plasminogen activator |
|---|
| Ensembl ID | ENSP00000361850 |
|---|
| Symbol | ATF QPD UPA URK u-PA BDPLT5 |
|---|
| Family | Belongs to the peptidase S1 family. |
|---|
| Sequence | MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 738078 | PLAU | plasminogen activator, urokinase | 9598 | | OMA, EggNOG |
| Macaque | 705853 | PLAU | plasminogen activator, urokinase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18792 | Plau | plasminogen activator, urokinase | 10090 | MGI:97611 | Inparanoid, OMA, EggNOG |
| Rat | 25619 | Plau | plasminogen activator, urokinase | 10116 | RGD:3343 | Inparanoid, OMA, EggNOG |
| Dog | 403426 | PLAU | plasminogen activator, urokinase | 9615 | VGNC:52017 | Inparanoid, OMA, EggNOG |
| Horse | 100072886 | PLAU | plasminogen activator, urokinase | 9796 | VGNC:21530 | Inparanoid, OMA, EggNOG |
| Cow | 281408 | PLAU | plasminogen activator, urokinase | 9913 | VGNC:32975 | Inparanoid, OMA, EggNOG |
| Pig | 396985 | PLAU | plasminogen activator, urokinase | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | PLAU | plasminogen activator, urokinase [Source:HGNC Symbol;Acc:HGNC:9052] | 13616 | | Inparanoid, EggNOG |
| Platypus | 100079618 | PLAU | plasminogen activator, urokinase | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 396424 | PLAU | plasminogen activator, urokinase | 9031 | CGNC:3784 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552401 | plau | plasminogen activator, urokinase | 28377 | | Inparanoid, OMA, EggNOG |
| Zebrafish | 100008445 | plaua | plasminogen activator, urokinase a | 7955 | ZDB-GENE-090313-278 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
serine protease / Urokinase-type plasminogen activator
protein /
protease / Urokinase-type plasminogen activator
protein /
hydrolase / Urokinase-type plasminogen activator
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
