The store will not work correctly when cookies are disabled.
VKORC1
| Description | Vitamin K epoxide reductase complex subunit 1 |
|---|
Gene and Protein Information
| Gene ID | 79001 |
|---|
| Uniprot Accession IDs | A6NIQ6 B2R4Z6 Q6UX90 Q7Z2R4 |
|---|
| Ensembl ID | ENSP00000378426 |
|---|
| Symbol | VKOR VKOR MST134 MST576 VKCFD2 EDTP308 |
|---|
| Family | Belongs to the VKOR family. |
|---|
| Sequence | MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 100610370 | VKORC1 | vitamin K epoxide reductase complex subunit 1 | 9598 | VGNC:5952 | OMA, EggNOG |
| Mouse | 27973 | Vkorc1 | vitamin K epoxide reductase complex, subunit 1 | 10090 | MGI:106442 | Inparanoid, OMA |
| Rat | 309004 | Vkorc1 | vitamin K epoxide reductase complex, subunit 1 | 10116 | RGD:1303107 | Inparanoid, OMA |
| Dog | 479775 | VKORC1 | vitamin K epoxide reductase complex subunit 1 | 9615 | VGNC:54091 | Inparanoid, OMA |
| Cow | 445422 | VKORC1 | vitamin K epoxide reductase complex subunit 1 | 9913 | | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
oxidoreductase / Vitamin K epoxide reductase complex subunit 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
