The store will not work correctly when cookies are disabled.
SLC7A11
| Description | Cystine/glutamate transporter |
|---|
Gene and Protein Information
| Gene ID | 23657 |
|---|
| Uniprot Accession IDs | A8K2U4 |
|---|
| Ensembl ID | ENSP00000280612 |
|---|
| Symbol | xCT CCBR1 |
|---|
| Family | Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family. |
|---|
| Sequence | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471310 | SLC7A11 | solute carrier family 7 member 11 | 9598 | VGNC:50362 | OMA, EggNOG |
| Macaque | 696516 | SLC7A11 | solute carrier family 7 member 11 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 26570 | Slc7a11 | solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 | 10090 | MGI:1347355 | Inparanoid, OMA, EggNOG |
| Rat | 310392 | Slc7a11 | solute carrier family 7 member 11 | 10116 | RGD:1309275 | Inparanoid, OMA, EggNOG |
| Dog | 483821 | SLC7A11 | solute carrier family 7 member 11 | 9615 | VGNC:46472 | Inparanoid, OMA, EggNOG |
| Horse | 100063433 | SLC7A11 | solute carrier family 7 member 11 | 9796 | VGNC:23267 | Inparanoid, OMA, EggNOG |
| Cow | 524078 | SLC7A11 | solute carrier family 7 member 11 | 9913 | VGNC:34926 | Inparanoid, OMA, EggNOG |
| Opossum | 100027770 | SLC7A11 | solute carrier family 7 member 11 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 428731 | SLC7A11 | solute carrier family 7 member 11 | 9031 | CGNC:7416 | Inparanoid, OMA, EggNOG |
| Xenopus | | slc7a11 | solute carrier family 7 member 11 [Source:Xenbase;Acc:XB-GENE-960114] | 8364 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
