The store will not work correctly when cookies are disabled.
WNT1
| Description | Proto-oncogene Wnt-1 |
|---|
Gene and Protein Information
| Gene ID | 7471 |
|---|
| Uniprot Accession IDs | Q5U0N2 |
|---|
| Ensembl ID | ENSP00000293549 |
|---|
| Symbol | INT1 INT1 OI15 BMND16 |
|---|
| Family | Belongs to the Wnt family. |
|---|
| Sequence | MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 742674 | WNT1 | Wnt family member 1 | 9598 | VGNC:10083 | OMA, EggNOG |
| Macaque | 709009 | WNT1 | Wnt family member 1 | 9544 | | Inparanoid, OMA |
| Mouse | 22408 | Wnt1 | wingless-type MMTV integration site family, member 1 | 10090 | MGI:98953 | Inparanoid, OMA, EggNOG |
| Rat | 24881 | Wnt1 | Wnt family member 1 | 10116 | RGD:1597195 | Inparanoid, OMA |
| Dog | 486560 | WNT1 | Wnt family member 1 | 9615 | VGNC:48419 | Inparanoid, OMA, EggNOG |
| Horse | 100058859 | WNT1 | Wnt family member 1 | 9796 | VGNC:25041 | Inparanoid, OMA, EggNOG |
| Cow | 540662 | WNT1 | Wnt family member 1 | 9913 | VGNC:36953 | Inparanoid, OMA, EggNOG |
| Pig | | WNT1 | Wnt family member 1 [Source:HGNC Symbol;Acc:HGNC:12774] | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100032741 | WNT1 | Wnt family member 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562340 | wnt1 | Wnt family member 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100491444 | wnt1 | Wnt family member 1 | 8364 | XB-GENE-485280 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30128 | wnt1 | wingless-type MMTV integration site family, member 1 | 7955 | ZDB-GENE-980526-526 | Inparanoid, OMA |
Protein Classes
DTO Classes protein /
Signaling / Proto-oncogene Wnt-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
