The store will not work correctly when cookies are disabled.
XBP1
| Description | X-box-binding protein 1 |
|---|
Gene and Protein Information
| Gene ID | 7494 |
|---|
| Uniprot Accession IDs | Q8WYK6 Q969P1 Q96BD7 XBP-1 |
|---|
| Ensembl ID | ENSP00000216037 |
|---|
| Symbol | TREB5 XBP2 XBP2 TREB5 XBP-1 TREB-5 |
|---|
| Family | Belongs to the bZIP family. |
|---|
| Sequence | MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 458735 | XBP1 | X-box binding protein 1 | 9598 | VGNC:12945 | OMA, EggNOG |
| Macaque | 713863 | XBP1 | X-box binding protein 1 | 9544 | | OMA, EggNOG |
| Mouse | 22433 | Xbp1 | X-box binding protein 1 | 10090 | MGI:98970 | Inparanoid, EggNOG |
| Rat | 289754 | Xbp1 | X-box binding protein 1 | 10116 | RGD:1303073 | Inparanoid, OMA, EggNOG |
| Dog | 477532 | XBP1 | X-box binding protein 1 | 9615 | | OMA, EggNOG |
| Cow | 541236 | XBP1 | X-box binding protein 1 | 9913 | VGNC:53930 | Inparanoid, EggNOG |
| Xenopus | 407858 | xbp1 | X-box binding protein 1 | 8364 | XB-GENE-487124 | OMA, EggNOG |
| Zebrafish | 140614 | xbp1 | X-box binding protein 1 | 7955 | ZDB-GENE-011210-2 | OMA, EggNOG |
| Fruitfly | 44226 | Xbp1 | X box binding protein-1 | 7227 | FBgn0021872 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
