JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

X-box-binding protein 1

Gene ID	7494
uniprot	P17861
Gene Name	XBP1
Ensernbl ID	ENSP00000216037
Family	Belongs to the bZIP family.
Sequence	MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7494	XBP1	X-box-binding protein 1	P17861
MOUSE		Xbp1	Xbp1 protein	Q05DE6
MOUSE		Xbp1	X-box-binding protein 1	H3BLF6
MOUSE		Xbp1	X-box-binding protein 1	G3UYH6
MOUSE	22433	Xbp1	X-box-binding protein 1	O35426
RAT	289754	Xbp1	X-box-binding protein 1	A0A140TAA7
RAT	289754	Xbp1	X-box-binding protein 1	Q9R1S4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx