JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Synaptic vesicular amine transporter

Gene ID	6571
uniprot	Q05940
Gene Name	SLC18A2
Ensernbl ID	ENSP00000298472
Family	Belongs to the major facilitator superfamily. Vesicular transporter family.
Sequence	MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	6571	SLC18A2	Synaptic vesicular amine transporter	Q05940
MOUSE		Slc18a2	Slc18a2 protein	Q66L40
MOUSE	214084	Slc18a2	Synaptic vesicular amine transporter	Q8BRU6
RAT	25549	Slc18a2	Solute carrier family 18 (Vesicular monoamine), member 2, isoform CRA_a	A0A0G2JSJ6
RAT	25549	Slc18a2	Synaptic vesicular amine transporter	Q01827

Protein Classes

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC18 family of vesicular amine transporters / Synaptic vesicular amine transporter

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx