The store will not work correctly when cookies are disabled.
Protein or Target Summary
Vitamin D-binding protein
Gene ID | 2638 |
uniprot | P02774 |
Gene Name | GC |
Ensernbl ID | ENSP00000421725 |
Family | Belongs to the ALB/AFP/VDB family. |
Sequence | MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 2638 | GC | Vitamin D-binding protein | P02774 |
MOUSE | | Gc | Vitamin D-binding protein | A0A0G2JGM6 |
MOUSE | 14473 | Gc | Vitamin D-binding protein | P21614 |
RAT | 24384 | Gc | Group specific component | Q68FY4 |
RAT | | Gc | Vitamin D-binding protein | P04276 |
Protein Classes
DTO Classes protein /
Transporter / Vitamin D-binding protein
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|