Protein or Target Summary
WAP four-disulfide core domain protein 2
Gene ID | 10406 |
---|---|
uniprot | Q14508 |
Gene Name | WFDC2 |
Ensernbl ID | ENSP00000361761 |
Sequence | MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 10406 | WFDC2 | WAP four-disulfide core domain protein 2 | Q14508 |
MOUSE | Wfdc2 | WAP four-disulfide core domain protein 2 | A2A5G4 | |
MOUSE | 67701 | Wfdc2 | WAP four-disulfide core domain protein 2 | A2A5G5 |
MOUSE | Wfdc2 | WAP four-disulfide core domain protein 2 | A2A5G6 | |
MOUSE | 67701 | Wfdc2 | WAP four-disulfide core domain 2 | Q4FZJ6 |
MOUSE | 67701 | Wfdc2 | WAP four-disulfide core domain protein 2 | Q9DAU7 |
RAT | 286888 | Wfdc2 | WAP four-disulfide core domain protein 2 | Q8CHN3 |
Protein Classes
PANTHER Classes
protein / enzyme modulator / serine protease inhibitor / WAP four-disulfide core domain protein 2
protein / enzyme modulator / serine protease inhibitor / WAP four-disulfide core domain protein 2
DTO Classes
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / WAP four-disulfide core domain protein 2
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / WAP four-disulfide core domain protein 2
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: TCRDv6_DataSourcesLicenses.xlsx