WFDC2

Description	WAP four-disulfide core domain protein 2

Gene and Protein Information

Gene ID	10406
Uniprot Accession IDs	A2A2A5 A2A2A6 A6PVD5 Q6IB27 Q8WXV9 Q8WXW0 Q8WXW1 Q8WXW2 Q96KJ1
Ensembl ID	ENSP00000361761
Symbol	HE4 WAP5 HE4 WAP5 EDDM4 dJ461P17.6
Sequence	MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458283	WFDC2	WAP four-disulfide core domain 2	9598	VGNC:10138	OMA, EggNOG
Macaque	710469	WFDC2	WAP four-disulfide core domain 2	9544		Inparanoid, OMA, EggNOG
Mouse	67701	Wfdc2	WAP four-disulfide core domain 2	10090	MGI:1914951	Inparanoid, OMA, EggNOG
Rat	286888	Wfdc2	WAP four-disulfide core domain 2	10116	RGD:628757	Inparanoid, OMA, EggNOG
Dog	403919	WFDC2	WAP four-disulfide core domain 2	9615	VGNC:54267	Inparanoid, OMA, EggNOG
Horse	100056252	WFDC2	WAP four-disulfide core domain 2	9796	VGNC:25027	Inparanoid, OMA, EggNOG
Cow	618044	WFDC2	WAP four-disulfide core domain 2	9913	VGNC:36933	Inparanoid, OMA, EggNOG
Opossum	100030064	WFDC2	WAP four-disulfide core domain 2	13616		Inparanoid, EggNOG

PANTHER Classes
protein / enzyme modulator / serine protease inhibitor / WAP four-disulfide core domain protein 2

DTO Classes
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / WAP four-disulfide core domain protein 2

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source