Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

WAP four-disulfide core domain protein 2

Gene ID10406
uniprotQ14508
Gene NameWFDC2
Ensernbl IDENSP00000361761
Sequence
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN10406WFDC2WAP four-disulfide core domain protein 2Q14508
MOUSEWfdc2WAP four-disulfide core domain protein 2A2A5G4
MOUSE67701Wfdc2WAP four-disulfide core domain protein 2A2A5G5
MOUSEWfdc2WAP four-disulfide core domain protein 2A2A5G6
MOUSE67701Wfdc2WAP four-disulfide core domain 2Q4FZJ6
MOUSE67701Wfdc2WAP four-disulfide core domain protein 2Q9DAU7
RAT286888Wfdc2WAP four-disulfide core domain protein 2Q8CHN3

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    WAP four-disulfide core domain protein 2
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    WAP four-disulfide core domain protein 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source