The store will not work correctly when cookies are disabled.
WNT8B
Description | Protein Wnt-8b |
---|
Gene and Protein Information
Gene ID | 7479 |
Uniprot Accession IDs | O00771 Q5VX55 Q8WYK9 |
Ensembl ID | ENSP00000340677 |
Family | Belongs to the Wnt family. |
Sequence | MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 466182 | WNT8B | Wnt family member 8B | 9598 | VGNC:9783 | OMA, EggNOG |
Macaque | 710242 | WNT8B | Wnt family member 8B | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 22423 | Wnt8b | wingless-type MMTV integration site family, member 8B | 10090 | MGI:109485 | Inparanoid, OMA, EggNOG |
Rat | 293990 | Wnt8b | Wnt family member 8B | 10116 | RGD:1307644 | Inparanoid, OMA, EggNOG |
Dog | 486841 | WNT8B | Wnt family member 8B | 9615 | VGNC:48430 | Inparanoid, OMA, EggNOG |
Horse | 100070360 | WNT8B | Wnt family member 8B | 9796 | VGNC:25051 | Inparanoid, OMA |
Cow | 538720 | WNT8B | Wnt family member 8B | 9913 | VGNC:36965 | Inparanoid, OMA |
Pig | 100513655 | WNT8B | Wnt family member 8B | 9823 | | Inparanoid, OMA |
Opossum | 100027787 | WNT8B | Wnt family member 8B | 13616 | | Inparanoid, EggNOG |
Chicken | 428953 | WNT8B | Wnt family member 8B | 9031 | CGNC:53518 | Inparanoid, OMA |
Anole lizard | 100564473 | wnt8b | Wnt family member 8B | 28377 | | Inparanoid, OMA |
Xenopus | 100496786 | wnt8b | Wnt family member 8B | 8364 | XB-GENE-492636 | OMA, EggNOG |
Zebrafish | 30144 | wnt8b | wingless-type MMTV integration site family, member 8b | 7955 | ZDB-GENE-990415-279 | Inparanoid, OMA |
Protein Classes
DTO Classes protein /
Signaling / Protein Wnt-8b
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|