WNT8B

DescriptionProtein Wnt-8b

Gene and Protein Information

Gene ID7479
Uniprot Accession IDs O00771 Q5VX55 Q8WYK9
Ensembl ID ENSP00000340677
FamilyBelongs to the Wnt family.
Sequence
MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp466182WNT8BWnt family member 8B9598VGNC:9783OMA, EggNOG
Macaque710242WNT8BWnt family member 8B9544Inparanoid, OMA, EggNOG
Mouse22423Wnt8bwingless-type MMTV integration site family, member 8B10090MGI:109485Inparanoid, OMA, EggNOG
Rat293990Wnt8bWnt family member 8B10116RGD:1307644Inparanoid, OMA, EggNOG
Dog486841WNT8BWnt family member 8B9615VGNC:48430Inparanoid, OMA, EggNOG
Horse100070360WNT8BWnt family member 8B9796VGNC:25051Inparanoid, OMA
Cow538720WNT8BWnt family member 8B9913VGNC:36965Inparanoid, OMA
Pig100513655WNT8BWnt family member 8B9823Inparanoid, OMA
Opossum100027787WNT8BWnt family member 8B13616Inparanoid, EggNOG
Chicken428953WNT8BWnt family member 8B9031CGNC:53518Inparanoid, OMA
Anole lizard100564473wnt8bWnt family member 8B28377Inparanoid, OMA
Xenopus100496786wnt8bWnt family member 8B8364XB-GENE-492636OMA, EggNOG
Zebrafish30144wnt8bwingless-type MMTV integration site family, member 8b7955ZDB-GENE-990415-279Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    Protein Wnt-8b
DTO Classes
protein    /    Signaling    /    Protein Wnt-8b

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source