Protein or Target Summary

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4

Gene ID	10785
uniprot	P57081
Gene Name	WDR4
Ensernbl ID	ENSP00000381266
Family	Belongs to the WD repeat TRM82 family.
Sequence	MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10785	WDR4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	P57081
MOUSE		Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	F7CM37
MOUSE	57773	Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	E9Q156
MOUSE		Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	E9Q1L4
MOUSE		Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	E9Q1H7
MOUSE		Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	F6VLT8
MOUSE		Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	F6YNC4
MOUSE	57773	Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	Q9EP82
RAT	690032	Wdr4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	D4A0Q3

Protein Classes

PANTHER Classes
protein / nucleic acid binding / mRNA processing factor / tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4

DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx