The store will not work correctly when cookies are disabled.
UBE2Z
| Description | Ubiquitin-conjugating enzyme E2 Z |
|---|
Gene and Protein Information
| Gene ID | 65264 |
|---|
| Uniprot Accession IDs | A6N8M6 A6NC60 Q7L354 Q8TCM4 Q9H893 |
|---|
| Ensembl ID | ENSP00000354201 |
|---|
| Symbol | USE1 HOYS7 |
|---|
| Family | Belongs to the ubiquitin-conjugating enzyme family. |
|---|
| Sequence | MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 455196 | UBE2Z | ubiquitin conjugating enzyme E2 Z | 9598 | VGNC:9762 | OMA, EggNOG |
| Mouse | 268470 | Ube2z | ubiquitin-conjugating enzyme E2Z | 10090 | MGI:1343160 | Inparanoid, OMA, EggNOG |
| Rat | 303478 | Ube2z | ubiquitin-conjugating enzyme E2Z | 10116 | RGD:1308347 | Inparanoid, OMA, EggNOG |
| Dog | 491062 | UBE2Z | ubiquitin conjugating enzyme E2 Z | 9615 | VGNC:48067 | Inparanoid, OMA |
| Horse | 100069535 | UBE2Z | ubiquitin conjugating enzyme E2 Z | 9796 | VGNC:24729 | Inparanoid, OMA, EggNOG |
| Cow | 100138178 | UBE2Z | ubiquitin conjugating enzyme E2 Z | 9913 | VGNC:36598 | Inparanoid, OMA, EggNOG |
| Pig | 100523993 | UBE2Z | ubiquitin conjugating enzyme E2 Z | 9823 | | OMA, EggNOG |
| Opossum | 100021140 | UBE2Z | ubiquitin conjugating enzyme E2 Z | 13616 | | Inparanoid, OMA |
| Chicken | 419991 | UBE2Z | ubiquitin conjugating enzyme E2 Z | 9031 | CGNC:899 | Inparanoid, OMA |
| Anole lizard | 100552398 | ube2z | ubiquitin conjugating enzyme E2 Z | 28377 | | Inparanoid, OMA |
| Xenopus | 493338 | ube2z | ubiquitin conjugating enzyme E2Z | 8364 | XB-GENE-990986 | Inparanoid, OMA |
| Zebrafish | 436602 | ube2z | ubiquitin-conjugating enzyme E2Z | 7955 | ZDB-GENE-040718-15 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
