The store will not work correctly when cookies are disabled.
Protein or Target Summary
Ubiquitin-conjugating enzyme E2 Z
| Gene ID | 65264 |
|---|
| uniprot | Q9H832 |
|---|
| Gene Name | UBE2Z |
|---|
| Ensernbl ID | ENSP00000354201 |
|---|
| Family | Belongs to the ubiquitin-conjugating enzyme family. |
|---|
| Sequence | MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 65264 | UBE2Z | Ubiquitin-conjugating enzyme E2 Z | Q9H832 |
| MOUSE | 268470 | Ube2z | Ubiquitin-conjugating enzyme E2 Z | Q3UE37 |
| RAT | 303478 | Ube2z | Ubiquitin-conjugating enzyme E2 Z | Q3B7D1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
