JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
CTNNBIP1

CTNNBIP1

Description	Beta-catenin-interacting protein 1

Gene and Protein Information

Gene ID	56998
Uniprot Accession IDs	Q5T4V2
Ensembl ID	ENSP00000366474
Symbol	ICAT ICAT
Family	Belongs to the CTNNBIP1 family.
Sequence	MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	67087	Ctnnbip1	catenin beta interacting protein 1	10090	MGI:1915756	Inparanoid, OMA, EggNOG
Rat	503000	Ctnnbip1	catenin, beta-interacting protein 1	10116	RGD:1562749	Inparanoid, OMA, EggNOG
Dog	479600	LOC479600	beta-catenin-interacting protein 1	9615		OMA, EggNOG
Horse	100630146	CTNNBIP1	catenin beta interacting protein 1	9796	VGNC:50681	Inparanoid, OMA, EggNOG
Cow	614630	CTNNBIP1	catenin beta interacting protein 1	9913	VGNC:27803	Inparanoid, OMA, EggNOG
Opossum	100024685	CTNNBIP1	catenin beta interacting protein 1	13616		Inparanoid, OMA, EggNOG
Platypus	100090884	CTNNBIP1	catenin beta interacting protein 1	9258		Inparanoid, OMA, EggNOG
Chicken	771460	CTNNBIP1	catenin beta interacting protein 1	9031	CGNC:66666	Inparanoid, OMA
Anole lizard	100551881	ctnnbip1	catenin beta interacting protein 1	28377		Inparanoid, OMA, EggNOG
Xenopus	493465	ctnnbip1	catenin beta interacting protein 1	8364	XB-GENE-486352	Inparanoid, OMA, EggNOG
Zebrafish	58117	ctnnbip1	catenin, beta interacting protein 1	7955	ZDB-GENE-000906-3	Inparanoid, OMA

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source