The store will not work correctly when cookies are disabled.
Protein or Target Summary
Beta-catenin-interacting protein 1
| Gene ID | 56998 |
|---|
| uniprot | Q9NSA3 |
|---|
| Gene Name | CTNNBIP1 |
|---|
| Ensernbl ID | ENSP00000366474 |
|---|
| Family | Belongs to the CTNNBIP1 family. |
|---|
| Sequence | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 56998 | CTNNBIP1 | Beta-catenin-interacting protein 1 | Q9NSA3 |
| MOUSE | 67087 | Ctnnbip1 | Beta-catenin-interacting protein 1 | Q9JJN6 |
| RAT | 503000 | Ctnnbip1 | Catenin, beta-interacting protein 1 | Q4KM58 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
