The store will not work correctly when cookies are disabled.
Protein or Target Summary
Beta-catenin-interacting protein 1
Gene ID | 56998 |
uniprot | Q9NSA3 |
Gene Name | CTNNBIP1 |
Ensernbl ID | ENSP00000366474 |
Family | Belongs to the CTNNBIP1 family. |
Sequence | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 56998 | CTNNBIP1 | Beta-catenin-interacting protein 1 | Q9NSA3 |
MOUSE | 67087 | Ctnnbip1 | Beta-catenin-interacting protein 1 | Q9JJN6 |
RAT | 503000 | Ctnnbip1 | Catenin, beta-interacting protein 1 | Q4KM58 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|