The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
XRCC5
Description | X-ray repair cross-complementing protein 5 |
---|
Gene and Protein Information
Gene ID | 7520 |
Uniprot Accession IDs | P13010 A8K3X5 Q0Z7V0 Q4VBQ5 Q53HH7 Q7M4N0 Q9UCQ0 Q9UCQ1 |
Ensembl ID | ENSP00000375978 |
Symbol | G22P2 KU80 KUB2 Ku86 NFIV KARP1 KARP-1 |
Family | Belongs to the ku80 family. |
Sequence | MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 449614 | XRCC5 | X-ray repair cross complementing 5 | 9598 | VGNC:3879 | OMA, EggNOG |
Macaque | 574279 | XRCC5 | X-ray repair cross complementing 5 | 9544 | | Inparanoid, EggNOG |
Mouse | 22596 | Xrcc5 | X-ray repair complementing defective repair in Chinese hamster cells 5 | 10090 | MGI:104517 | Inparanoid, OMA, EggNOG |
Rat | 363247 | Xrcc5 | X-ray repair cross complementing 5 | 10116 | RGD:3976 | Inparanoid, OMA, EggNOG |
Dog | 478902 | XRCC5 | X-ray repair cross complementing 5 | 9615 | VGNC:48469 | Inparanoid, OMA, EggNOG |
Horse | 100055031 | XRCC5 | X-ray repair cross complementing 5 | 9796 | VGNC:25083 | Inparanoid, OMA, EggNOG |
Cow | 531945 | XRCC5 | X-ray repair cross complementing 5 | 9913 | VGNC:37006 | Inparanoid, OMA, EggNOG |
Pig | 100514133 | XRCC5 | X-ray repair cross complementing 5 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100013619 | XRCC5 | X-ray repair cross complementing 5 | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 424222 | XRCC5 | X-ray repair cross complementing 5 | 9031 | CGNC:8733 | Inparanoid, OMA, EggNOG |
Anole lizard | 100558367 | xrcc5 | X-ray repair cross complementing 5 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | | XRCC5 | X-ray repair cross complementing 5 [Source:HGNC Symbol;Acc:HGNC:12833] | 8364 | | OMA, EggNOG |
Zebrafish | 449848 | xrcc5 | X-ray repair complementing defective repair in Chinese hamster cells 5 | 7955 | ZDB-GENE-041008-108 | Inparanoid, OMA |
Fruitfly | 34930 | Ku80 | CG18801 gene product from transcript CG18801-RA | 7227 | FBgn0041627 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Bibliography
The page will load shortly, Thanks for your patience!