The store will not work correctly when cookies are disabled.
Protein or Target Summary
Vascular endothelial growth factor A
Gene ID | 7422 |
uniprot | P15692 |
Gene Name | VEGFA |
Ensernbl ID | ENSP00000478570 |
Family | Belongs to the PDGF/VEGF growth factor family. |
Sequence | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 7422 | VEGFA | Vascular endothelial growth factor A | P15692 |
MOUSE | | Vegfa | Vascular endothelial growth factor A | Q6YLN3 |
MOUSE | | Vegfa | Vascular endothelial growth factor A | F8WH10 |
MOUSE | | Vegfa | Vascular endothelial growth factor A | E9Q4N8 |
MOUSE | | Vegfa | Vascular endothelial growth factor A | F8WH81 |
MOUSE | | Vegfa | Vascular endothelial growth factor A | E9Q4N9 |
MOUSE | | Vegfa | Vascular endothelial growth factor 165b | F8T7H0 |
MOUSE | 22339 | Vegfa | Vascular endothelial growth factor A | F6ZE01 |
MOUSE | 22339 | Vegfa | Vascular endothelial growth factor A | A0A1L1SVG2 |
MOUSE | | Vegfa | Vascular endothelial growth factor A isoform 5 | A0FKR4 |
MOUSE | | Vegfa | Vascular endothelial growth factor A isoform | Q5UD54 |
MOUSE | 22339 | Vegfa | Vascular endothelial growth factor A | Q00731 |
RAT | | Vegfa | Vascular endothelial growth factor A | F8WG85 |
RAT | | Vegfa | Vascular endothelial growth factor A | G8JLS5 |
RAT | | Vegfa | Vascular endothelial growth factor | Q91ZE2 |
RAT | 83785 | Vegfa | Vascular endothelial growth factor A | B5DEK7 |
RAT | | Vegfa | Vascular endothelial growth factor A | A0A0H2UHY5 |
RAT | | Vegfa | Vascular endothelial growth factor A | F1M6X1 |
RAT | 83785 | Vegfa | Vascular endothelial growth factor A | A0A0G2K6Z7 |
RAT | 83785 | Vegfa | Vascular endothelial growth factor A, isoform CRA_f | Q541S7 |
RAT | 83785 | Vegfa | Vascular endothelial growth factor A | P16612 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|