Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Vascular endothelial growth factor A

Gene ID7422
uniprotP15692
Gene NameVEGFA
Ensernbl IDENSP00000478570
FamilyBelongs to the PDGF/VEGF growth factor family.
Sequence
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN7422VEGFAVascular endothelial growth factor AP15692
MOUSEVegfaVascular endothelial growth factor AQ6YLN3
MOUSEVegfaVascular endothelial growth factor AF8WH10
MOUSEVegfaVascular endothelial growth factor AE9Q4N8
MOUSEVegfaVascular endothelial growth factor AF8WH81
MOUSEVegfaVascular endothelial growth factor AE9Q4N9
MOUSEVegfaVascular endothelial growth factor 165bF8T7H0
MOUSE22339VegfaVascular endothelial growth factor AF6ZE01
MOUSE22339VegfaVascular endothelial growth factor AA0A1L1SVG2
MOUSEVegfaVascular endothelial growth factor A isoform 5A0FKR4
MOUSEVegfaVascular endothelial growth factor A isoformQ5UD54
MOUSE22339VegfaVascular endothelial growth factor AQ00731
RATVegfaVascular endothelial growth factor AF8WG85
RATVegfaVascular endothelial growth factor AG8JLS5
RATVegfaVascular endothelial growth factorQ91ZE2
RAT83785VegfaVascular endothelial growth factor AB5DEK7
RATVegfaVascular endothelial growth factor AA0A0H2UHY5
RATVegfaVascular endothelial growth factor AF1M6X1
RAT83785VegfaVascular endothelial growth factor AA0A0G2K6Z7
RAT83785VegfaVascular endothelial growth factor A, isoform CRA_fQ541S7
RAT83785VegfaVascular endothelial growth factor AP16612

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Vascular endothelial growth factor A
DTO Classes
protein    /    Signaling    /    Growth factor    /    Vascular endothelial growth factor A

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source