JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
UBE2T

UBE2T

Description	Ubiquitin-conjugating enzyme E2 T

Gene and Protein Information

Gene ID	29089
Uniprot Accession IDs	Q2TU36
Ensembl ID	ENSP00000356243
Symbol	FANCT PIG50 HSPC150
Family	Belongs to the ubiquitin-conjugating enzyme family.
Sequence	MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	457628	UBE2T	ubiquitin conjugating enzyme E2 T	9598	VGNC:7020	OMA, EggNOG
Macaque	705911	UBE2T	ubiquitin conjugating enzyme E2 T	9544		OMA, EggNOG
Mouse	67196	Ube2t	ubiquitin-conjugating enzyme E2T	10090	MGI:1914446	Inparanoid, OMA, EggNOG
Rat	360847	Ube2t	ubiquitin-conjugating enzyme E2T	10116	RGD:1310816	Inparanoid, OMA, EggNOG
Dog	607154	UBE2T	ubiquitin conjugating enzyme E2 T	9615	VGNC:48066	Inparanoid, OMA, EggNOG
Horse		UBE2T	ubiquitin conjugating enzyme E2 T [Source:HGNC Symbol;Acc:HGNC:25009]	9796		OMA, EggNOG
Cow	505314	UBE2T	ubiquitin conjugating enzyme E2 T	9913	VGNC:36596	Inparanoid, OMA, EggNOG
Chicken	421149	UBE2T	ubiquitin conjugating enzyme E2 T	9031	CGNC:48	Inparanoid, OMA, EggNOG
Zebrafish	768152	ube2t	ubiquitin-conjugating enzyme E2T (putative)	7955	ZDB-GENE-061013-547	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source