| Description | Ubiquitin carboxyl-terminal hydrolase isozyme L5 |
|---|
Gene and Protein Information
| Gene ID | 51377 |
|---|---|
| Uniprot Accession IDs | Q5LJA6 Q5LJA7 Q8TBS4 Q96BJ9 Q9H1W5 Q9P0I3 Q9UQN2 UCH-L5 |
| Ensembl ID | ENSP00000356425 |
| Symbol | UCH37 UCH37 CGI-70 INO80R UCH-L5 |
| Family | Belongs to the peptidase C12 family. |
| Sequence | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457596 | UCHL5 | ubiquitin C-terminal hydrolase L5 | 9598 | VGNC:10906 | OMA, EggNOG |
| Mouse | 56207 | Uchl5 | ubiquitin carboxyl-terminal esterase L5 | 10090 | MGI:1914848 | Inparanoid, OMA, EggNOG |
| Rat | 360853 | Uchl5 | ubiquitin C-terminal hydrolase L5 | 10116 | RGD:1305414 | Inparanoid, OMA, EggNOG |
| Dog | 478958 | UCHL5 | ubiquitin C-terminal hydrolase L5 | 9615 | VGNC:48105 | Inparanoid, OMA, EggNOG |
| Horse | UCHL5 | ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678] | 9796 | OMA, EggNOG | ||
| Cow | 282110 | UCHL5 | ubiquitin C-terminal hydrolase L5 | 9913 | VGNC:36633 | Inparanoid, OMA, EggNOG |
| Pig | 100144472 | UCHL5 | ubiquitin C-terminal hydrolase L5 | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | UCHL5 | ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678] | 9258 | OMA, EggNOG | ||
| Chicken | 424359 | UCHL5 | ubiquitin C-terminal hydrolase L5 | 9031 | CGNC:1810 | Inparanoid, OMA |
| Anole lizard | 100561706 | uchl5 | ubiquitin C-terminal hydrolase L5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100124308 | uchl5 | ubiquitin C-terminal hydrolase L5 | 8364 | XB-GENE-968743 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406357 | uchl5 | ubiquitin carboxyl-terminal hydrolase L5 | 7955 | ZDB-GENE-040426-2051 | Inparanoid, OMA |
| C. elegans | 174289 | ubh-4 | Probable ubiquitin carboxyl-terminal hydrolase ubh-4 | 6239 | Inparanoid, OMA | |
| Fruitfly | 39102 | Uch-L5 | Ubiquitin carboxy-terminal hydrolase L5 | 7227 | FBgn0011327 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / cysteine protease / Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein / protease / Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein / hydrolase / Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein / cysteine protease / Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein / protease / Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein / hydrolase / Ubiquitin carboxyl-terminal hydrolase isozyme L5
DTO Classes
protein / Enzyme / Protease / Cysteine protease / Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein / Enzyme / Protease / Cysteine protease / Ubiquitin carboxyl-terminal hydrolase isozyme L5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|