Protein or Target Summary

Ubiquitin carboxyl-terminal hydrolase isozyme L5

Gene ID	51377
uniprot	Q9Y5K5
Gene Name	UCHL5
Ensernbl ID	ENSP00000356425
Family	Belongs to the peptidase C12 family.
Sequence	MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	51377	UCHL5	Ubiquitin carboxyl-terminal hydrolase isozyme L5	Q9Y5K5
MOUSE		Uchl5	Ubiquitin carboxyl-terminal hydrolase isozyme L5	A0A087WP81
MOUSE		Uchl5	Ubiquitin carboxyl-terminal esterase L5, isoform CRA_a	A0A087WRL3
MOUSE	56207	Uchl5	Ubiquitin carboxyl-terminal hydrolase isozyme L5	Q9WUP7
RAT		Uchl5	Ubiquitin carboxyl-terminal hydrolase	A0A0G2K2A5
RAT	360853	Uchl5	Ubiquitin carboxyl-terminal hydrolase	Q5HZY3

Protein Classes

PANTHER Classes
protein    /    cysteine protease    /    Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein    /    protease    /    Ubiquitin carboxyl-terminal hydrolase isozyme L5
protein    /    hydrolase    /    Ubiquitin carboxyl-terminal hydrolase isozyme L5

DTO Classes
protein / Enzyme / Protease / Cysteine protease / Ubiquitin carboxyl-terminal hydrolase isozyme L5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx