The store will not work correctly when cookies are disabled.
VDAC2
| Description | Voltage-dependent anion-selective channel protein 2 |
|---|
Gene and Protein Information
| Gene ID | 7417 |
|---|
| Uniprot Accession IDs | Q5VWK1 Q5VWK3 Q6IB40 Q7L3J5 Q9BWK8 Q9Y5I6 VDAC-2 |
|---|
| Ensembl ID | ENSP00000361635 |
|---|
| Symbol | POR |
|---|
| Family | Belongs to the eukaryotic mitochondrial porin family. |
|---|
| Sequence | MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471721 | LOC471721 | voltage-dependent anion-selective channel protein 2 | 9598 | | OMA, EggNOG |
| Macaque | 704257 | VDAC2 | voltage dependent anion channel 2 | 9544 | | Inparanoid, OMA |
| Mouse | 22334 | Vdac2 | voltage-dependent anion channel 2 | 10090 | MGI:106915 | Inparanoid, OMA, EggNOG |
| Rat | 83531 | Vdac2 | voltage-dependent anion channel 2 | 10116 | RGD:621576 | Inparanoid, OMA, EggNOG |
| Dog | 479255 | VDAC2 | voltage dependent anion channel 2 | 9615 | VGNC:48247 | Inparanoid, OMA, EggNOG |
| Horse | 100064276 | VDAC2 | voltage dependent anion channel 2 | 9796 | VGNC:24896 | Inparanoid, OMA, EggNOG |
| Cow | 282120 | VDAC2 | voltage dependent anion channel 2 | 9913 | VGNC:36783 | Inparanoid, OMA, EggNOG |
| Pig | 397659 | VDAC2 | voltage dependent anion channel 2 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100012461 | VDAC2 | voltage dependent anion channel 2 | 13616 | | Inparanoid, EggNOG |
| Platypus | 100075011 | VDAC2 | voltage dependent anion channel 2 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 395498 | VDAC2 | voltage dependent anion channel 2 | 9031 | CGNC:49348 | Inparanoid, OMA |
| Anole lizard | 100565441 | vdac2 | voltage dependent anion channel 2 | 28377 | | Inparanoid, OMA |
| Xenopus | 548947 | vdac2 | voltage-dependent anion channel 2 | 8364 | XB-GENE-954839 | Inparanoid, OMA |
| Zebrafish | 322126 | vdac2 | voltage-dependent anion channel 2 | 7955 | ZDB-GENE-030131-845 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
